Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CD207 rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.)

Rabbit anti-Human, Mouse CD207 Polyclonal Antibody | anti-CD207 antibody

CD207 (C-type Lectin Domain Family 4 Member K, Langerin, CLEC4K) (Biotin)

Gene Names
CD207; CLEC4K
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD207; Polyclonal Antibody; CD207 (C-type Lectin Domain Family 4 Member K; Langerin; CLEC4K) (Biotin); anti-CD207 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD207. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1894
Applicable Applications for anti-CD207 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD207, aa1-199 (AAH22278.1).
Immunogen Sequence
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CD207 rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.)

Western Blot (WB) (CD207 rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of CD207 expression in transfected 293T cell line by CD207 polyclonal antibody. Lane 1: CD207 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD207 expression in transfected 293T cell line by CD207 polyclonal antibody. Lane 1: CD207 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD207 antibody
Langerin is a type II transmembrane protein with a single extracellular C-type lectin domain. It is a Langerhans cell restricted protein that plays a role as an endocytic receptor.
Product Categories/Family for anti-CD207 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens CD207 molecule, langerin, mRNA
NCBI Official Synonym Full Names
CD207 molecule
NCBI Official Symbol
CD207
NCBI Official Synonym Symbols
CLEC4K
NCBI Protein Information
C-type lectin domain family 4 member K

NCBI Description

The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity. [provided by RefSeq, Aug 2010]

Research Articles on CD207

Similar Products

Product Notes

The CD207 (Catalog #AAA6372929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD207 (C-type Lectin Domain Family 4 Member K, Langerin, CLEC4K) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD207 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD207 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD207, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.