Rabbit anti-Human CD1C Polyclonal Antibody | anti-CD1C antibody

CD1C Antibody - middle region

Cat. Num. AAA3221527

• Gene Names: CD1C; R7; CD1; CD1A; BDCA1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: CD1C; Polyclonal Antibody; CD1C Antibody - middle region; anti-CD1C antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: IFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQ
• Sequence Length: 333

• Applicable Applications for anti-CD1C antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human CD1C
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD1CSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-CD1C antibody

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.

Product Categories/Family for anti-CD1C antibody

Polyclonal; Membrane Protein; Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 110618227
• NCBI GeneID: 911
• NCBI Accession #: NP_001756.2
• NCBI GenBank Nucleotide #: NM_001765.2
• UniProt Accession #: P29017
• Molecular Weight: 36 kDa
• NCBI Official Full Name: T-cell surface glycoprotein CD1c
• NCBI Official Synonym Full Names: CD1c molecule
• NCBI Official Symbol: CD1C
• NCBI Official Synonym Symbols: R7; CD1; CD1A; BDCA1
• NCBI Protein Information: T-cell surface glycoprotein CD1c
• UniProt Protein Name: T-cell surface glycoprotein CD1c
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD1C
• UniProt Entry Name: CD1C_HUMAN

NCBI Description

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known. [provided by RefSeq, Jul 2008]