Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CD19Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CD19 Polyclonal Antibody | anti-CD19 antibody

CD19 Antibody - C-terminal region

Gene Names
CD19; B4; CVID3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CD19; Polyclonal Antibody; CD19 Antibody - C-terminal region; anti-CD19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTW
Sequence Length
557
Applicable Applications for anti-CD19 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CD19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD19Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CD19Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CD19 antibody
Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Product Categories/Family for anti-CD19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
930
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61 kDa
NCBI Official Full Name
B-lymphocyte antigen CD19 isoform 1
NCBI Official Synonym Full Names
CD19 molecule
NCBI Official Symbol
CD19
NCBI Official Synonym Symbols
B4; CVID3
NCBI Protein Information
B-lymphocyte antigen CD19
UniProt Protein Name
B-lymphocyte antigen CD19
Protein Family
UniProt Gene Name
CD19
UniProt Entry Name
CD19_HUMAN

NCBI Description

Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq, Jul 2008]

Uniprot Description

CD19: a cell surface molecule which assembles with the antigen receptor of B lymphocytes. A critical signal transduction molecule that regulates B lymphocyte development, activation, and differentiation. Ligation increases intracellular calcium levels and decreases the threshold for antigen receptor signaling. Germinal center formation is significantly reduced in CD19-deficient mice.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: protein complex; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: receptor signaling protein activity

Biological Process: epidermal growth factor receptor signaling pathway; B cell receptor signaling pathway; regulation of immune response; cell surface receptor linked signal transduction; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; cellular defense response; innate immune response; positive regulation of release of sequestered calcium ion into cytosol

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 3

Research Articles on CD19

Similar Products

Product Notes

The CD19 cd19 (Catalog #AAA3221021) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD19 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD19 cd19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGILYAAPQL RSIRGQPGPN HEEDADSYEN MDNPDGPDPA WGGGGRMGTW. It is sometimes possible for the material contained within the vial of "CD19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.