Rabbit anti-Human CD18 Polyclonal Antibody | anti-ITGB2 antibody

Anti-CD18 antibody

Cat. Num. AAA175688

• Gene Names: ITGB2; LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1
• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: CD18; Polyclonal Antibody; Anti-CD18 antibody; Integrin beta-2; integrin; beta 2(complement component 3 receptor 3 and 4 subunit); 95 subunit beta antibody; CD 18 antibody; CD18 antibody; Cell surface adhesion glycoprotein LFA 1/CR3/P150; 959 beta subunit precursor) antibody; Cell surface adhesion glycoproteins LFA 1/CR3/p150; Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody; Complement receptor C3 beta subunit antibody; Complement receptor C3 subunit beta antibody; Integrin beta 2 antibody; Integrin beta chain beta 2 antibody; Integrin beta-2 antibody; Integrin; beta 2(complement component 3 receptor 3 and 4 subunit) antibody; ITB2_HUMAN antibody; ITGB2 antibody; LAD antibody; LCAMB antibody; Leukocyte associated antigens CD18/11A; CD18/11B; CD18/11C antibody; Leukocyte cell adhesion molecule CD18 antibody; LFA 1 antibody; LFA1 antibody; Lymphocyte function associated antigen 1 antibody; MAC 1 antibody; MAC1 antibody; MF17 antibody; MFI7 antibody; OTTHUMP00000115278 antibody; OTTHUMP00000115279 antibody; OTTHUMP00000115280 antibody; OTTHUMP00000115281 antibody; OTTHUMP00000115282 antibody; anti-ITGB2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized
• Sequence Length: 769

• Applicable Applications for anti-ITGB2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot (WB); Concentration: 0.1-0.5ug/ml; Tested Species: Human; Immunohistochemistry (IHC); Concentration: 0.5-1 ug/ml; Tested Species: Human; Antigen Retreival: By Heat; ; Tested Species: In-house tested species with positive results.; Predicted Species: Species predicted to be fit for the product based on sequence similarities.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.; ; Other applicationshave not been tested.; Optimal dilutions should be determined by end users.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD18 (24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
• Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Immunohistochemistry (IHC)

(Anti-CD18 antibody, MBS175688, IHC(P)IHC(P): Human Uroepithelium Cancer Tissue )

Western Blot (WB)

(Anti-CD18 antibody, MBS175688, Western blottingAll lanes: Anti CD18 (MBS175688) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: HT1080 Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD )

Related Product Information for anti-ITGB2 antibody

The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the "inside-out" signaling pathways.

NCBI and Uniprot Product Information

• NCBI GI #: 124056465
• NCBI GeneID: 3689
• UniProt Accession #: P05107; Q16418; Q53HS5; Q9UD72; B3KTS8; D3DSM1
• NCBI Official Full Name: Integrin beta-2
• NCBI Official Synonym Full Names: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
• NCBI Official Symbol: ITGB2
• NCBI Official Synonym Symbols: LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1
• NCBI Protein Information: integrin beta-2; integrin beta chain, beta 2; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor)
• UniProt Protein Name: Integrin beta-2
• Protein Family: CD180 antigen
• UniProt Gene Name: ITGB2
• UniProt Synonym Gene Names: CD18; MFI7
• UniProt Entry Name: ITB2_HUMAN

NCBI Description

The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGB2: the integrin beta 2 subunit. Can combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Participates in cell adhesion as well as cell-surface mediated signaling. Defects are the cause of leukocyte adhesion deficiency type I (LAD1).

Protein type: Receptor, misc.; Membrane protein, integral; Cell surface; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: cell surface; membrane; plasma membrane; integrin complex; receptor complex; vesicle; lipid raft

Molecular Function: protein binding; protein heterodimerization activity; metal ion binding; protein complex binding; cell adhesion molecule binding; ICAM-3 receptor activity; glycoprotein binding; protein kinase binding

Biological Process: extracellular matrix organization and biogenesis; positive regulation of nitric oxide biosynthetic process; apoptosis; cell-matrix adhesion; natural killer cell activation; receptor clustering; activation of NF-kappaB transcription factor; regulation of cell shape; leukocyte adhesion; cellular extravasation; cell-cell signaling; cell adhesion; inflammatory response; regulation of peptidyl-tyrosine phosphorylation; toll-like receptor 4 signaling pathway; aging; integrin-mediated signaling pathway; neutrophil chemotaxis; regulation of immune response; activated T cell proliferation; leukocyte migration during inflammatory response; heterotypic cell-cell adhesion; positive regulation of angiogenesis; toll-like receptor signaling pathway; endothelial cell migration; innate immune response; blood coagulation; leukocyte migration

Disease: Leukocyte Adhesion Deficiency, Type I