Rabbit anti-Human CD178 Polyclonal Antibody | anti-CD178 antibody

CD178 (Apoptosis Antigen Ligand, APT1LG1, APTL, CD95 Ligand, CD95L, CD95-L, FAS Antigen Ligand, Fas Ligand, FASL, FASLG, Tumor Necrosis Factor Ligand Superfamily Member 6, TNFSF6) (Biotin)

Cat. Num. AAA6372852

• Gene Names: FASLG; APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD178; Polyclonal Antibody; CD178 (Apoptosis Antigen Ligand; APT1LG1; APTL; CD95 Ligand; CD95L; CD95-L; FAS Antigen Ligand; Fas Ligand; FASL; FASLG; Tumor Necrosis Factor Ligand Superfamily Member 6; TNFSF6) (Biotin); anti-CD178 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FASLG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 281

• Applicable Applications for anti-CD178 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FASLG, aa1-281 (AAH17502.1).
• Immunogen Sequence: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FASLG expression in transfected 293T cell line by FASLG polyclonal antibody. Lane 1: FASLG transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FASLG and FYN. HeLa cells were stained with FASLG rabbit purified polyclonal 1:1200 and FYN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-CD178 antibody

FAS Ligand (FASL) is a 40kD type II membrane protein belonging to the tumor necrosis factor family, which induces apoptosis by binding to its receptor, Fas. The human FasL gene consists of approximately 8kb and is split into four exons. This gene consists of 281aa with a calculated M(r) of 31,759 and was mapped on chromosome 1q23. It has an identity of 76.9% at the aa sequence level with mouse FasL. The FAS and FASL system plays a key role in regulating apoptotic cell death and corruption of this signalling pathway has been shown to participate in immune escape and tumorigenesis. FAS and FASL triggered apoptosis pathway plays an important role in human carcinogenesis. This system may also play a role in modulating the genetic susceptibility of mouse strains to develop T-cell lymphoblastic lymphomas.

Product Categories/Family for anti-CD178 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 17028381
• NCBI GeneID: 356
• NCBI Accession #: AAH17502.1
• NCBI GenBank Nucleotide #: NM_000639
• NCBI Official Full Name: Fas ligand (TNF superfamily, member 6)
• NCBI Official Synonym Full Names: Fas ligand
• NCBI Official Symbol: FASLG
• NCBI Official Synonym Symbols: APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 6

NCBI Description

This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2014]