Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human nasal epithelialApplication: IHCSpecies+tissue/cell type:Human nasal epithelial cellsPrimary antibody dilution: 1:1000Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000)

Rabbit CD151 Polyclonal Antibody | anti-CD151 antibody

CD151 antibody - C-terminal region

Gene Names
CD151; GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CD151; Polyclonal Antibody; CD151 antibody - C-terminal region; anti-CD151 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYK
Sequence Length
253
Applicable Applications for anti-CD151 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human nasal epithelialApplication: IHCSpecies+tissue/cell type:Human nasal epithelial cellsPrimary antibody dilution: 1:1000Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000)

Immunohistochemistry (IHC) (Sample Type: Human nasal epithelialApplication: IHCSpecies+tissue/cell type:Human nasal epithelial cellsPrimary antibody dilution: 1:1000Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000)

Western Blot (WB)

(WB Suggested Anti-CD151 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCD151 is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (WB Suggested Anti-CD151 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCD151 is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-CD151 antibody
This is a rabbit polyclonal antibody against CD151. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.
Product Categories/Family for anti-CD151 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
977
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
CD151 antigen
NCBI Official Synonym Full Names
CD151 molecule (Raph blood group)
NCBI Official Symbol
CD151
NCBI Official Synonym Symbols
GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24
NCBI Protein Information
CD151 antigen
UniProt Protein Name
CD151 antigen
Protein Family
UniProt Gene Name
CD151
UniProt Synonym Gene Names
TSPAN24; PETA-3; Tspan-24
UniProt Entry Name
CD151_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD151: Essential for the proper assembly of the glomerular and tubular basement membranes in kidney. Defects in CD151 are the cause of nephropathy with pretibial epidermolysis bullosa and deafness (NPEBD). NPEBD is characterized by the association of hereditary nephritis, epidermolysis bullosa, deafness, and beta-thalassemia minor. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: focal adhesion; membrane; integral to plasma membrane; plasma membrane; cytosol

Molecular Function: integrin binding; protein binding

Biological Process: T cell proliferation; extracellular matrix organization and biogenesis; cell migration; hemidesmosome assembly; cell adhesion

Disease: Raph Blood Group System; Nephropathy With Pretibial Epidermolysis Bullosa And Deafness

Research Articles on CD151

Similar Products

Product Notes

The CD151 cd151 (Catalog #AAA3216055) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD151 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD151 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CD151 cd151 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HCCGSNNSQD WRDSEWIRSQ EAGGRVVPDS CCKTVVALCG QRDHASNIYK. It is sometimes possible for the material contained within the vial of "CD151, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.