CD151 recombinant protein

CD151 Recombinant Protein

Cat. Num. AAA3003999

• Gene Names: CD151; GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD151; CD151 Recombinant Protein; CD151 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 339
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD151 recombinant protein

Background: CD151 (PETA-3, SFA-1) is a member of the evolutionarily conserved tetraspanin family of multipass glycoproteins (TM4SF), highlighted by four transmembrane domains, two extracellular loops, and N/C-termini that reside within the cytoplasm. Identified as the first member of the tetraspanin family to be implicated in tumorigenesis, research studies have demonstrated that CD151 participates in tumor neovascularization, tumor cell cell invasion, and cell adhesion. Furthermore, a positive correlation exists between CD151 expression levels and poor prognosis for tumors of the lung, kidney, and prostate. CD151 is localized predominantly to the plasma membrane and research studies have demonstrated that CD151 exerts its pro-tumorigenic effects, in part, through the modulation of laminin-binding integrins and oncogenic receptor tyrosine kinases, such as c-Met and EGFR.

NCBI and Uniprot Product Information

• NCBI GI #: 21237751
• NCBI GeneID: 977
• NCBI Accession #: NP_620599.1
• NCBI GenBank Nucleotide #: NM_139030.3
• UniProt Accession #: P48509; Q14826; Q86U54; Q96TE3; A8KAK8; E9PI15
• Molecular Weight: 28,295 Da
• NCBI Official Full Name: CD151 antigen
• NCBI Official Synonym Full Names: CD151 molecule (Raph blood group)
• NCBI Official Symbol: CD151
• NCBI Official Synonym Symbols: GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24
• NCBI Protein Information: CD151 antigen; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan ant
• UniProt Protein Name: CD151 antigen
• Protein Family: CD151 antigen
• UniProt Gene Name: CD151
• UniProt Synonym Gene Names: TSPAN24; PETA-3; Tspan-24
• UniProt Entry Name: CD151_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD151: Essential for the proper assembly of the glomerular and tubular basement membranes in kidney. Defects in CD151 are the cause of nephropathy with pretibial epidermolysis bullosa and deafness (NPEBD). NPEBD is characterized by the association of hereditary nephritis, epidermolysis bullosa, deafness, and beta-thalassemia minor. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: focal adhesion; membrane; integral to plasma membrane; plasma membrane; cytosol

Molecular Function: integrin binding; protein binding

Biological Process: T cell proliferation; extracellular matrix organization and biogenesis; cell migration; hemidesmosome assembly; cell adhesion

Disease: Raph Blood Group System; Nephropathy With Pretibial Epidermolysis Bullosa And Deafness