Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD109 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit CD109 Polyclonal Antibody | anti-CD109 antibody

CD109 antibody - middle region

Gene Names
CD109; p180; r150; CPAMD7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD109; Polyclonal Antibody; CD109 antibody - middle region; anti-CD109 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN
Sequence Length
1368
Applicable Applications for anti-CD109 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD109 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD109 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-CD109 antibody
This is a rabbit polyclonal antibody against CD109. It was validated on Western Blot

Target Description: This gene encodes a member of the alpha2-macroglobulin/complement superfamily. The encoded GPI-linked glycoprotein is found on the cell surface of platelets, activated T-cells, and endothelial cells. The protein binds to and negatively regulates signaling of transforming growth factor beta (TGF-beta). Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CD109 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
151kDa
NCBI Official Full Name
CD109 antigen isoform 3 preproprotein
NCBI Official Synonym Full Names
CD109 molecule
NCBI Official Symbol
CD109
NCBI Official Synonym Symbols
p180; r150; CPAMD7
NCBI Protein Information
CD109 antigen
UniProt Protein Name
CD109 antigen
Protein Family
UniProt Gene Name
CD109
UniProt Synonym Gene Names
CPAMD7
UniProt Entry Name
CD109_HUMAN

NCBI Description

This gene encodes a glycosyl phosphatidylinositol (GPI)-linked glycoprotein that localizes to the surface of platelets, activated T-cells, and endothelial cells. The protein binds to and negatively regulates signalling by transforming growth factor beta (TGF-beta). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

CD109: Modulates negatively TGFB1 signaling in keratinocytes. Belongs to the protease inhibitor I39 (alpha-2- macroglobulin) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6q13

Cellular Component: extracellular space; cell surface; plasma membrane

Molecular Function: serine-type endopeptidase inhibitor activity; transforming growth factor beta binding

Biological Process: hair follicle development; negative regulation of protein amino acid phosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; regulation of keratinocyte differentiation

Research Articles on CD109

Similar Products

Product Notes

The CD109 cd109 (Catalog #AAA3216306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD109 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD109 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD109 cd109 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLYWSKVKAE PSEKVSLRIS VTQPDSIVGI VAVDKSVNLM NASNDITMEN. It is sometimes possible for the material contained within the vial of "CD109, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.