Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCT8L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit CCT8L2 Polyclonal Antibody | anti-CCT8L2 antibody

CCT8L2 antibody - middle region

Gene Names
CCT8L2; CESK1
Reactivity
Guinea Pig, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCT8L2; Polyclonal Antibody; CCT8L2 antibody - middle region; anti-CCT8L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR
Sequence Length
557
Applicable Applications for anti-CCT8L2 antibody
Western Blot (WB)
Homology
Guinea Pig: 75%; Human: 100%; Rabbit: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCT8L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCT8L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-CCT8L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-CCT8L2 antibody
This is a rabbit polyclonal antibody against CCT8L2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.
Product Categories/Family for anti-CCT8L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
T-complex protein 1 subunit theta-like 2
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 8 like 2
NCBI Official Symbol
CCT8L2
NCBI Official Synonym Symbols
CESK1
NCBI Protein Information
T-complex protein 1 subunit theta-like 2
UniProt Protein Name
Putative T-complex protein 1 subunit theta-like 2
Protein Family
UniProt Gene Name
CCT8L2
UniProt Synonym Gene Names
CESK1
UniProt Entry Name
TCPQM_HUMAN

Similar Products

Product Notes

The CCT8L2 cct8l2 (Catalog #AAA3202488) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCT8L2 antibody - middle region reacts with Guinea Pig, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CCT8L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCT8L2 cct8l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGINVAVVLG EVDEETLTLA DKYGIVVIQA RSWMEIIYLS EVLDTPLLPR. It is sometimes possible for the material contained within the vial of "CCT8L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.