Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of CCT3 using anti- CCT3 antibody (MBS178426). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat kidney tissue lysates, Lane 2: HELA whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- CCT3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CCT3 at approximately 61KD. The expected band size for CCT3 is at 61KD. )

Rabbit CCT3 Polyclonal Antibody | anti-CCT3 antibody

Anti-CCT3 Antibody

Gene Names
CCT3; CCTG; PIG48; TRIC5; CCT-gamma; TCP-1-gamma
Reactivity
Human, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
CCT3; Polyclonal Antibody; Anti-CCT3 Antibody; CCT 3; CCT gamma; CCT-gamma; CCTG; CCT G; hTRiC5; PIG48; TCP 1 gamma; TCP-1-gamma; TRIC5; P49368; T-complex protein 1 subunit gamma; chaperonin containing TCP1 subunit 3; anti-CCT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
507
Applicable Applications for anti-CCT3 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of CCT3 using anti- CCT3 antibody (MBS178426). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat kidney tissue lysates, Lane 2: HELA whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- CCT3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CCT3 at approximately 61KD. The expected band size for CCT3 is at 61KD. )

Western Blot (WB) (Figure 1. Western blot analysis of CCT3 using anti- CCT3 antibody (MBS178426). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat kidney tissue lysates, Lane 2: HELA whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- CCT3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CCT3 at approximately 61KD. The expected band size for CCT3 is at 61KD. )

Flow Cytometry (FC/FACS)

(Figure 2. Flow Cytometry analysis of K562 cells using anti-CCT3 antibody (MBS178426).Overlay histogram showing K562 cells stained with MBS178426 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (MBS178426,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control )

Flow Cytometry (FC/FACS) (Figure 2. Flow Cytometry analysis of K562 cells using anti-CCT3 antibody (MBS178426).Overlay histogram showing K562 cells stained with MBS178426 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (MBS178426,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control )

Flow Cytometry (FC/FACS)

(Figure 3. Flow Cytometry analysis of PC-3 cells using anti-CCT3 antibody (MBS178426).Overlay histogram showing PC-3 cells stained with MBS178426 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (MBS178426,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )

Flow Cytometry (FC/FACS) (Figure 3. Flow Cytometry analysis of PC-3 cells using anti-CCT3 antibody (MBS178426).Overlay histogram showing PC-3 cells stained with MBS178426 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (MBS178426,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )

Flow Cytometry (FC/FACS)

(Figure 4. Flow Cytometry analysis of U251 cells using anti-CCT3 antibody (MBS178426).Overlay histogram showing U251 cells stained with MBS178426 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (MBS178426,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )

Flow Cytometry (FC/FACS) (Figure 4. Flow Cytometry analysis of U251 cells using anti-CCT3 antibody (MBS178426).Overlay histogram showing U251 cells stained with MBS178426 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCT3 Antibody (MBS178426,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )
Related Product Information for anti-CCT3 antibody
Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma (CCT3) detection.
Background: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
References
1. "Entrez Gene: CCT3 chaperonin containing TCP1, subunit 3 (gamma)".
2. Joly EC, Sévigny G, Todorov IT, Bibor-Hardy V (Mar 1994). "cDNA encoding a novel TCP1-related protein".Biochimica et Biophysica Acta 1217 (2): 224-6.
3. Walkley NA, Demaine AG, Malik AN (Jan 1996)."Cloning, structure and mRNA expression of human Cctg, which encodes the chaperonin subunit CCT gamma". The Biochemical Journal 313 (Pt 2): 381-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,431 Da
NCBI Official Full Name
T-complex protein 1 subunit gamma isoform c
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 3
NCBI Official Symbol
CCT3
NCBI Official Synonym Symbols
CCTG; PIG48; TRIC5; CCT-gamma; TCP-1-gamma
NCBI Protein Information
T-complex protein 1 subunit gamma
UniProt Protein Name
T-complex protein 1 subunit gamma
Protein Family
UniProt Gene Name
CCT3
UniProt Synonym Gene Names
CCTG; TRIC5; TCP-1-gamma
UniProt Entry Name
TCPG_HUMAN

NCBI Description

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Aug 2010]

Uniprot Description

CCT3: Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. Belongs to the TCP-1 chaperonin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Chaperone

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: chaperonin-containing T-complex; cytoplasm; cytoskeleton; cytosol; microtubule; plasma membrane

Molecular Function: protein binding

Biological Process: positive regulation of telomere maintenance via telomerase; protein folding; protein stabilization

Research Articles on CCT3

Similar Products

Product Notes

The CCT3 cct3 (Catalog #AAA178426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CCT3 Antibody reacts with Human, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's CCT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the CCT3 cct3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.