Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CCRL2 Polyclonal Antibody | anti-CCRL2 antibody

CCRL2 (Chemokine (C-C Motif) Receptor-like 2, CKRX, CRAM-A, CRAM-B, FLJ55815, HCR, MGC116710) (MaxLight 650)

Gene Names
CCRL2; HCR; CKRX; CRAM; ACKR5; CCRL2; CRAM-A; CRAM-B
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
CCRL2; Polyclonal Antibody; CCRL2 (Chemokine (C-C Motif) Receptor-like 2; CKRX; CRAM-A; CRAM-B; FLJ55815; HCR; MGC116710) (MaxLight 650); Chemokine (C-C Motif) Receptor-like 2; MGC116710; anti-CCRL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCRL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CCRL2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CCRL2 (NP_003956.2, 1aa-344aa) full-length human protein.
Immunogen Sequence
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CCRL2 antibody
This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq]
Product Categories/Family for anti-CCRL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,952 Da
NCBI Official Full Name
C-C chemokine receptor-like 2 isoform 1
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor-like 2
NCBI Official Symbol
CCRL2
NCBI Official Synonym Symbols
HCR; CKRX; CRAM; ACKR5; CCRL2; CRAM-A; CRAM-B
NCBI Protein Information
C-C chemokine receptor-like 2; chemokine receptor X; chemokine receptor CCR11; atypical chemokine receptor 5; putative MCP-1 chemokine receptor
UniProt Protein Name
C-C chemokine receptor-like 2
Protein Family
UniProt Gene Name
CCRL2
UniProt Synonym Gene Names
CCR11; CCR6; CKRX; CRAM; HCR
UniProt Entry Name
CCRL2_HUMAN

NCBI Description

This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq, Jul 2008]

Uniprot Description

CCRL2: Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: CCR chemokine receptor binding; chemokine receptor binding; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; chemotaxis; inflammatory response

Research Articles on CCRL2

Similar Products

Product Notes

The CCRL2 ccrl2 (Catalog #AAA6450626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCRL2 (Chemokine (C-C Motif) Receptor-like 2, CKRX, CRAM-A, CRAM-B, FLJ55815, HCR, MGC116710) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCRL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCRL2 ccrl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCRL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.