Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCR8Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Rabbit CCR8 Polyclonal Antibody | anti-CCR8 antibody

CCR8 antibody - middle region

Gene Names
CCR8; CY6; TER1; CCR-8; CKRL1; CDw198; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8
Reactivity
Cow, Human, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
CCR8; Polyclonal Antibody; CCR8 antibody - middle region; anti-CCR8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
Sequence Length
355
Applicable Applications for anti-CCR8 antibody
Western Blot (WB)
Homology
Cow: 93%; Human: 100%; Rabbit: 81%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCR8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCR8Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCR8Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CCR8 Antibody Titration: 2.5ug/mlPositive Control: K562 cell lysateCCR8 is supported by BioGPS gene expression data to be expressed in K562)

Western Blot (WB) (WB Suggested Anti-CCR8 Antibody Titration: 2.5ug/mlPositive Control: K562 cell lysateCCR8 is supported by BioGPS gene expression data to be expressed in K562)
Related Product Information for anti-CCR8 antibody
This is a rabbit polyclonal antibody against CCR8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
C-C chemokine receptor type 8
NCBI Official Synonym Full Names
C-C motif chemokine receptor 8
NCBI Official Symbol
CCR8
NCBI Official Synonym Symbols
CY6; TER1; CCR-8; CKRL1; CDw198; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8
NCBI Protein Information
C-C chemokine receptor type 8
UniProt Protein Name
C-C chemokine receptor type 8
Protein Family
UniProt Gene Name
CCR8
UniProt Synonym Gene Names
CKRL1; CMKBR8; CMKBRL2; C-C CKR-8; CC-CKR-8; CCR-8; CKR-L1; GPRCY6
UniProt Entry Name
CCR8_HUMAN

NCBI Description

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. This gene is located at the chemokine receptor gene cluster region. [provided by RefSeq, Jul 2008]

Uniprot Description

CCR8: Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p22

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity; coreceptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; immune response; chemotaxis; cell adhesion

Research Articles on CCR8

Similar Products

Product Notes

The CCR8 ccr8 (Catalog #AAA3224463) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCR8 antibody - middle region reacts with Cow, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CCR8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCR8 ccr8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATIPLLVFY QVASEDGVLQ CYSFYNQQTL KWKIFTNFKM NILGLLIPFT. It is sometimes possible for the material contained within the vial of "CCR8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.