Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CCR3 Polyclonal Antibody | anti-CCR3 antibody

Anti-Human CCR3 DyLight 550 conjugated Antibody

Gene Names
CCR3; CKR3; CD193; CMKBR3; CC-CKR-3
Reactivity
Human
Applications
Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
CCR3; Polyclonal Antibody; Anti-Human CCR3 DyLight 550 conjugated Antibody; Rabbit IgG Polyclonal Anti-Human CCR3 Antibody DyLight 550 Conjugated; Flow Validated; C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CKR3; Eosinophil eotaxin receptor; CD193; CMKBR3; Chemokine (C-C motif) receptor 3; anti-CCR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Liquid
Sequence Length
376
Applicable Applications for anti-CCR3 antibody
Flow Cytometry (FC/FACS)
Application Notes
FC/FACS: 1-3ug/1x106 cells
Immunogen
A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA).
Preparation and Storage
Store at 2-8 degree C for one year. Protect from light. Do not freeze.
Related Product Information for anti-CCR3 antibody
C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
References
1. Blanchard, C., Wang, N., Stringer, K. F., Mishra, A., Fulkerson, P. C., Abonia, J. P., Jameson, S. C., Kirby, C., Konikoff, M. R., Collins, M. H., Cohen, M. B., Akers, R., Hogan, S. P., Assa'ad, A. H., Putnam, P. E., Aronow, B. J., Rothenberg, M. E. Eotaxin-3 and a uniquely conserved gene-expression profile in eosinophilic esophagitis. J. Clin. Invest. 116: 536-547, 2006. 2. Takeda, A., Baffi, J. Z., Kleinman, M. E., Cho, W. G., Nozaki, M., Yamada, K., Kaneko, H., Albuquerque, R. J. C., Dridi, S., Saito, K., Raisler, B. J., Budd, S. J., and 15 others. CCR3 is a target for age-related macular degeneration diagnosis and therapy. Nature 460: 225-230, 2009.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,453 Da
NCBI Official Full Name
C-C chemokine receptor type 3 isoform 1
NCBI Official Synonym Full Names
C-C motif chemokine receptor 3
NCBI Official Symbol
CCR3
NCBI Official Synonym Symbols
CKR3; CD193; CMKBR3; CC-CKR-3
NCBI Protein Information
C-C chemokine receptor type 3
UniProt Protein Name
C-C chemokine receptor type 3
Protein Family
UniProt Gene Name
CCR3
UniProt Synonym Gene Names
CMKBR3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3

NCBI Description

The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. Alternatively spliced transcript variants have been described. [provided by RefSeq, Sep 2009]

Uniprot Description

Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.MiscellaneousOverexpression of CCR3 together with its ligands appears to be a characteristic of ulcerative colitis (UC). The production of CCR3 ligands by human colonic epithelial cells suggests further that the epithelium can play a role in modulating pathological T-cell-mediated mucosal inflammation (PubMed:21077277).

Research Articles on CCR3

Similar Products

Product Notes

The CCR3 ccr3 (Catalog #AAA1751379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Human CCR3 DyLight 550 conjugated Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCR3 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS). FC/FACS: 1-3ug/1x106 cells. Researchers should empirically determine the suitability of the CCR3 ccr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.