Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCL24 expression in transfected 293T cell line by CCL24 polyclonal antibody. Lane 1: CCL24 transfected lysate (13.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CCL24 Polyclonal Antibody | anti-CCL24 antibody

CCL24 (C-C Motif Chemokine 24, CK-beta-6, Eosinophil Chemotactic Protein 2, Eotaxin-2, Myeloid Progenitor Inhibitory Factor 2, MPIF-2, Small-inducible Cytokine A24, MPIF2, SCYA24) (FITC)

Gene Names
CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL24; Polyclonal Antibody; CCL24 (C-C Motif Chemokine 24; CK-beta-6; Eosinophil Chemotactic Protein 2; Eotaxin-2; Myeloid Progenitor Inhibitory Factor 2; MPIF-2; Small-inducible Cytokine A24; MPIF2; SCYA24) (FITC); anti-CCL24 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCL24.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CCL24 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCL24, aa1-119 (NP_002982.2).
Immunogen Sequence
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCL24 expression in transfected 293T cell line by CCL24 polyclonal antibody. Lane 1: CCL24 transfected lysate (13.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCL24 expression in transfected 293T cell line by CCL24 polyclonal antibody. Lane 1: CCL24 transfected lysate (13.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCL24 antibody
Eotaxin 2 is an eosinophil-specific chemokine which is expressed principally by the jejunum and spleen. Expression is induced by allergen challenge.
Product Categories/Family for anti-CCL24 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,134 Da
NCBI Official Full Name
C-C motif chemokine 24
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 24
NCBI Official Symbol
CCL24
NCBI Official Synonym Symbols
Ckb-6; MPIF2; MPIF-2; SCYA24
NCBI Protein Information
C-C motif chemokine 24; CK-beta-6; eosinophil chemotactic protein 2; eotaxin-2; myeloid progenitor inhibitory factor 2; small inducible cytokine subfamily A (Cys-Cys), member 24; small-inducible cytokine A24
UniProt Protein Name
C-C motif chemokine 24
Protein Family
UniProt Gene Name
CCL24
UniProt Synonym Gene Names
MPIF2; SCYA24; MPIF-2
UniProt Entry Name
CCL24_HUMAN

NCBI Description

This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008]

Uniprot Description

CCL24: Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: extracellular space

Molecular Function: chemokine activity

Biological Process: cytoskeleton organization and biogenesis; chemotaxis; signal transduction; regulation of cell shape; positive regulation of angiogenesis; positive regulation of actin filament polymerization; cell-cell signaling; eosinophil chemotaxis; immune response; positive regulation of endothelial cell proliferation; inflammatory response; positive regulation of inflammatory response; positive regulation of cell migration

Research Articles on CCL24

Similar Products

Product Notes

The CCL24 ccl24 (Catalog #AAA6372589) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL24 (C-C Motif Chemokine 24, CK-beta-6, Eosinophil Chemotactic Protein 2, Eotaxin-2, Myeloid Progenitor Inhibitory Factor 2, MPIF-2, Small-inducible Cytokine A24, MPIF2, SCYA24) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL24 ccl24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.