Rabbit anti-Human CCL13 Polyclonal Antibody | anti-CCL13 antibody

CCL13 (C-C Motif Chemokine 13, CK-beta-10, Monocyte Chemoattractant Protein 4, Monocyte Chemotactic Protein 4, MCP-4, NCC-1, Small-inducible Cytokine A13, MCP4, NCC1, SCYA13, MGC17134) (HRP)

Cat. Num. AAA6372513

• Gene Names: CCL13; NCC1; CKb10; MCP-4; NCC-1; SCYL1; SCYA13
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CCL13; Polyclonal Antibody; CCL13 (C-C Motif Chemokine 13; CK-beta-10; Monocyte Chemoattractant Protein 4; Monocyte Chemotactic Protein 4; MCP-4; NCC-1; Small-inducible Cytokine A13; MCP4; NCC1; SCYA13; MGC17134) (HRP); anti-CCL13 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CCL13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-CCL13 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CCL13, aa1-98 (NP_005399.1).
• Immunogen Sequence: MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCL13 expression in transfected 293T cell line by CCL13 polyclonal antibody. Lane 1: CCL13 transfected lysate (11kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CCL13 antibody

CCL13 is a small cytokine belonging to the CC chemokine family that is also known as thymus and activation regulated chemokine (TARC). This protein induces chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils by binding cell surface G-protein linked chemokine receptors such as CCR2, CCR3 and CCR5. It can be induced by the inflammatory cytokines interleukin-1 and TNF-a.

Product Categories/Family for anti-CCL13 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4885587
• NCBI GeneID: 6357
• NCBI Accession #: NP_005399.1
• NCBI GenBank Nucleotide #: NM_005408
• UniProt Accession #: Q99616; O95689; Q6ICQ6
• Molecular Weight: 10,986 Da
• NCBI Official Full Name: C-C motif chemokine 13
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 13
• NCBI Official Symbol: CCL13
• NCBI Official Synonym Symbols: NCC1; CKb10; MCP-4; NCC-1; SCYL1; SCYA13
• NCBI Protein Information: C-C motif chemokine 13; CK-beta-10; monocyte chemoattractant protein 4; monocyte chemotactic protein 4; new CC chemokine 1; small inducible cytokine subfamily A (Cys-Cys), member 13; small-inducible cytokine A13
• UniProt Protein Name: C-C motif chemokine 13
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL13
• UniProt Synonym Gene Names: MCP4; NCC1; SCYA13; MCP-4
• UniProt Entry Name: CCL13_HUMAN

NCBI Description

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL13: Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. Signals through CCR2B and CCR3 receptors. Plays a role in the accumulation of leukocytes at both sides of allergic and non-allergic inflammation. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. May play a role in the monocyte attraction in tissues chronically exposed to exogenous pathogens. By IL1/interleukin-1 and TNF. Widely expressed. Found in small intestine, thymus, colon, lung, trachea, stomach and lymph node. Low levels seen in the pulmonary artery smooth muscle cells. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Chemokine; Secreted

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: extracellular space

Molecular Function: chemokine activity; receptor binding

Biological Process: cellular calcium ion homeostasis; regulation of cell shape; cell-cell signaling; eosinophil chemotaxis; cytoskeleton organization and biogenesis; immune response; signal transduction; inflammatory response; chemotaxis