Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCDC6Sample Tissue: Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CCDC6 Polyclonal Antibody | anti-CCDC6 antibody

CCDC6 Antibody - C-terminal region

Gene Names
CCDC6; H4; PTC; TPC; TST1; D10S170
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCDC6; Polyclonal Antibody; CCDC6 Antibody - C-terminal region; anti-CCDC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: HMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQP
Sequence Length
474
Applicable Applications for anti-CCDC6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C region of human CCDC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCDC6Sample Tissue: Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCDC6Sample Tissue: Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCDC6 antibody
This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Product Categories/Family for anti-CCDC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
coiled-coil domain-containing protein 6
NCBI Official Synonym Full Names
coiled-coil domain containing 6
NCBI Official Symbol
CCDC6
NCBI Official Synonym Symbols
H4; PTC; TPC; TST1; D10S170
NCBI Protein Information
coiled-coil domain-containing protein 6
UniProt Protein Name
Coiled-coil domain-containing protein 6
UniProt Gene Name
CCDC6
UniProt Synonym Gene Names
D10S170; TST1

NCBI Description

This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.[provided by RefSeq, Sep 2010]

Uniprot Description

CCDC6: Defects in CCDC6 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving CCDC6 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.

Protein type: Apoptosis; Cytoskeletal; Oncoprotein

Chromosomal Location of Human Ortholog: 10q21.2

Cellular Component: cytoplasm

Molecular Function: protein binding; structural constituent of cytoskeleton

Disease: Thyroid Carcinoma, Papillary

Research Articles on CCDC6

Similar Products

Product Notes

The CCDC6 ccdc6 (Catalog #AAA3219684) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC6 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCDC6 ccdc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HMGTSHGITR PSPRRSNSPD KFKRPTPPPS PNTQTPVQPP PPPPPPPMQP. It is sometimes possible for the material contained within the vial of "CCDC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.