Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of CCDC6 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). CCDC6 at 66KD was detected using rabbit anti- CCDC6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Rat CCDC6 Polyclonal Antibody | anti-CCDC6 antibody

Anti-CCDC6 Antibody

Gene Names
CCDC6; H4; PTC; TPC; TST1; D10S170
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
CCDC6; Polyclonal Antibody; Anti-CCDC6 Antibody; CCDC 6; D10S170; H4; Protein H4; PTC; TPC; TST1; TST 1; Q16204; Coiled-coil domain-containing protein 6; anti-CCDC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
474
Applicable Applications for anti-CCDC6 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of CCDC6 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). CCDC6 at 66KD was detected using rabbit anti- CCDC6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of CCDC6 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). CCDC6 at 66KD was detected using rabbit anti- CCDC6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CCDC6 antibody
Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection.
Background: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
References
1. Anne-Spence M, Falk CT, Neiswanger K, Field LL, Marazita ML, Allen FH, Siervogel RM, Roche AF, Crandall BF, Sparkes RS (Sep 1984). "Estimating the recombination frequency for the PTC-Kell linkage". Human Genetics 67(2): 183-6.
2. Grieco M, Cerrato A, Santoro M, Fusco A, Melillo RM, Vecchio G (Sep 1994). "Cloning and characterization of H4 (D10S170), a gene involved in RET rearrangements in vivo". Oncogene 9 (9): 2531-5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,291 Da
NCBI Official Full Name
coiled-coil domain-containing protein 6
NCBI Official Synonym Full Names
coiled-coil domain containing 6
NCBI Official Symbol
CCDC6
NCBI Official Synonym Symbols
H4; PTC; TPC; TST1; D10S170
NCBI Protein Information
coiled-coil domain-containing protein 6
UniProt Protein Name
Coiled-coil domain-containing protein 6
UniProt Gene Name
CCDC6
UniProt Synonym Gene Names
D10S170; TST1

NCBI Description

This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.[provided by RefSeq, Sep 2010]

Uniprot Description

CCDC6: Defects in CCDC6 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving CCDC6 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.

Protein type: Apoptosis; Cytoskeletal; Oncoprotein

Chromosomal Location of Human Ortholog: 10q21.2

Cellular Component: cytoplasm

Molecular Function: protein binding; structural constituent of cytoskeleton

Disease: Thyroid Carcinoma, Papillary

Research Articles on CCDC6

Similar Products

Product Notes

The CCDC6 ccdc6 (Catalog #AAA178806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CCDC6 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CCDC6 ccdc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCDC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.