Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CBX7 polyclonal antibody. Western Blot analysis of CBX7 expression in Hela NE.)

Mouse anti-Human CBX7 Polyclonal Antibody | anti-CBX7 antibody

CBX7 (Chromobox Protein Homolog 7)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CBX7; Polyclonal Antibody; CBX7 (Chromobox Protein Homolog 7); Anti -CBX7 (Chromobox Protein Homolog 7); anti-CBX7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CBX7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Applicable Applications for anti-CBX7 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CBX7, aa1-251 (NP_783640.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CBX7 polyclonal antibody. Western Blot analysis of CBX7 expression in Hela NE.)

Western Blot (WB) (CBX7 polyclonal antibody. Western Blot analysis of CBX7 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of CBX7 expression in transfected 293T cell line by CBX7 polyclonal antibody. Lane 1: CBX7 transfected lysate (27.61kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CBX7 expression in transfected 293T cell line by CBX7 polyclonal antibody. Lane 1: CBX7 transfected lysate (27.61kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CBX7 antibody
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
Product Categories/Family for anti-CBX7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,341 Da
NCBI Official Full Name
chromobox protein homolog 7
NCBI Official Synonym Full Names
chromobox homolog 7
NCBI Official Symbol
CBX7
NCBI Protein Information
chromobox protein homolog 7
UniProt Protein Name
Chromobox protein homolog 7
Protein Family
UniProt Gene Name
CBX7
UniProt Entry Name
CBX7_HUMAN

Uniprot Description

CBX7: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; heterochromatin; cytoplasm; nuclear chromatin; PcG protein complex; nucleus

Molecular Function: protein binding; single-stranded RNA binding; chromatin binding; methylated histone residue binding

Biological Process: transcription, DNA-dependent; sebaceous gland development; negative regulation of transcription from RNA polymerase II promoter; chromatin modification

Research Articles on CBX7

Similar Products

Product Notes

The CBX7 cbx7 (Catalog #AAA6004633) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CBX7 (Chromobox Protein Homolog 7) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBX7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CBX7 cbx7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELSAIGEQV FAVESIRKKR VRKGKVEYLV KWKGWPPKYS TWEPEEHILD PRLVMAYEEK EERDRASGYR KRGPKPKRLL LQRLYSMDLR SSHKAKGKEK LCFSLTCPLG SGSPEGVVKA GAPELVDKGP LVPTLPFPLR KPRKAHKYLR LSRKKFPPRG PNLESHSHRR ELFLQEPPAP DVLQAAGEWE PAAQPPEEEA DADLAEGPPP WTPALPSSEV TVTDITANSI TVTFREAQAA EGFFRDRSGK F. It is sometimes possible for the material contained within the vial of "CBX7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.