Rabbit anti-Human CBX5 Polyclonal Antibody | anti-CBX5 antibody

CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (PE)

Cat. Num. AAA6372442

• Gene Names: CBX5; HP1; HP1A; HEL25
• Reactivity: Human
• Applications: Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CBX5; Polyclonal Antibody; CBX5 (Chromobox Protein Homolog 5; Antigen p25; Heterochromatin Protein 1 Homolog alpha; HP1 alpha; HP1A) (PE); anti-CBX5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CBX5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CBX5 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length human CBX5, aa1-191 (NP_036249.1).
• Immunogen Sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CBX5 rabbit polyclonal antibody. Western Blot analysis of CBX5 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of CBX5 expression in transfected 293T cell line by CBX5 polyclonal antibody. Lane 1: CBX5 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified rabbit antibody to CBX5 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-CBX5 antibody

Antibodies; Chromatin Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 6912292
• NCBI GeneID: 23468
• NCBI Accession #: NP_036249.1
• NCBI GenBank Nucleotide #: NM_012117.1
• UniProt Accession #: P45973; B2R8T9
• Molecular Weight: 22,225 Da
• NCBI Official Full Name: chromobox protein homolog 5
• NCBI Official Synonym Full Names: chromobox homolog 5
• NCBI Official Symbol: CBX5
• NCBI Official Synonym Symbols: HP1; HP1A; HEL25
• NCBI Protein Information: chromobox protein homolog 5; HP1-ALPHA; HP1Hs alpha; antigen p25; HP1 alpha homolog; epididymis luminal protein 25; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila)
• UniProt Protein Name: Chromobox protein homolog 5
• Protein Family: Chromobox protein
• UniProt Gene Name: CBX5
• UniProt Synonym Gene Names: HP1A; HP1 alpha
• UniProt Entry Name: CBX5_HUMAN

NCBI Description

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

HP1 alpha: Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Interacts with SUV420H1 and SUV420H2. Interacts with HP1BP3. Interacts directly with ATRX, CHAF1A, LBR, NIPBL, SP100, STAM2 and TRIM28 via the chromoshadow domain. Can interact directly with CBX3 via the chromoshadow domain. Interacts with histone H3 methylated at 'Lys- 9'. Interacts with BAHD1, MIS12 and DSN1. Interacts with POGZ; POGZ and PXVXL motif-containing proteins such as INCENP and TRIM28 compete for interaction with CBX5. Interacts with INCENP and TRIM24. Interacts with JC virus agnoprotein; this interaction induces the dissociation of CBX5 from LBR, resulting in destabilization of the nuclear envelope. Interacts with CHAMP1. Interacts with ASXL1.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: kinetochore; nucleoplasm; PML body; histone methyltransferase complex; transcriptional repressor complex; histone deacetylase complex; nucleolus; nuclear envelope; nuclear heterochromatin; nucleus; chromocenter

Molecular Function: protein binding, bridging; protein binding; protein homodimerization activity; histone deacetylase binding; chromatin binding; methylated histone residue binding

Biological Process: viral reproduction; negative regulation of transcription, DNA-dependent; blood coagulation