Western Blot (WB)
(WB Suggested Anti-CBX2 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateCBX2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Rabbit CBX2 Polyclonal Antibody | anti-CBX2 antibody
CBX2 antibody - middle region
Gene Names
CBX2; M33; CDCA6; SRXY5
Reactivity
Cow, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CBX2; Polyclonal Antibody; CBX2 antibody - middle region; anti-CBX2 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT
Sequence Length
532
Applicable Applications for anti-CBX2 antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 93%; Human: 100%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CBX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CBX2 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateCBX2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Western Blot (WB)
(WB Suggested Anti-CBX2 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateCBX2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-CBX2 antibody
This is a rabbit polyclonal antibody against CBX2. It was validated on Western Blot
Target Description: CBX2 Contains 1 A.T hook DNA-binding domain and 1 chromo domain. CBX2 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Target Description: CBX2 Contains 1 A.T hook DNA-binding domain and 1 chromo domain. CBX2 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Product Categories/Family for anti-CBX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
chromobox protein homolog 2 isoform 1
NCBI Official Synonym Full Names
chromobox 2
NCBI Official Symbol
CBX2
NCBI Official Synonym Symbols
M33; CDCA6; SRXY5
NCBI Protein Information
chromobox protein homolog 2
UniProt Protein Name
Chromobox protein homolog 2
Protein Family
UniProt Gene Name
CBX2
UniProt Entry Name
CBX2_HUMAN
NCBI Description
This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2010]
Research Articles on CBX2
Similar Products
Product Notes
The CBX2 cbx2 (Catalog #AAA3213861) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBX2 antibody - middle region reacts with Cow, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CBX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CBX2 cbx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDSDPDSASP PSTGQNPSVS VQTSQDWKPT RSLIEHVFVT DVTANLITVT. It is sometimes possible for the material contained within the vial of "CBX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
