Western Blot (WB)
(WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateCBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit anti-Human CBFA2T3 Polyclonal Antibody | anti-CBFA2T3 antibody
CBFA2T3 antibody - N-terminal region
Gene Names
CBFA2T3; ETO2; MTG16; MTGR2; ZMYND4; RUNX1T3
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
CBFA2T3; Polyclonal Antibody; CBFA2T3 antibody - N-terminal region; anti-CBFA2T3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
Sequence Length
545
Applicable Applications for anti-CBFA2T3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateCBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateCBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-CBFA2T3 antibody
This is a rabbit polyclonal antibody against CBFA2T3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of CBFA2T3. In addition, CBFA2T3 is a putative breast tumor suppressor.
Target Description: The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of CBFA2T3. In addition, CBFA2T3 is a putative breast tumor suppressor.
Product Categories/Family for anti-CBFA2T3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60kDa
NCBI Official Full Name
MTG16
NCBI Official Synonym Full Names
CBFA2/RUNX1 translocation partner 3
NCBI Official Symbol
CBFA2T3
NCBI Official Synonym Symbols
ETO2; MTG16; MTGR2; ZMYND4; RUNX1T3
NCBI Protein Information
protein CBFA2T3
Protein Family
NCBI Description
This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(16;21)(q24;q22) translocation is one of the less common karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. This gene is also a putative breast tumor suppressor. Alternative splicing results in transcript variants. [provided by RefSeq, Nov 2010]
Research Articles on CBFA2T3
Similar Products
Product Notes
The CBFA2T3 (Catalog #AAA3204160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBFA2T3 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBFA2T3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CBFA2T3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPASRLRDRA ASSASGSTCG SMSQTHPVLE SGLLASAGCS APRGPRKGGP. It is sometimes possible for the material contained within the vial of "CBFA2T3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
