Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CATSPER2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlCATSPER2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit CATSPER2 Polyclonal Antibody | anti-CATSPER2 antibody

CATSPER2 antibody - N-terminal region

Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CATSPER2; Polyclonal Antibody; CATSPER2 antibody - N-terminal region; anti-CATSPER2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Sequence Length
414
Applicable Applications for anti-CATSPER2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CATSPER2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CATSPER2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlCATSPER2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: CATSPER2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlCATSPER2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(WB Suggested Anti-CATSPER2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-CATSPER2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-CATSPER2 antibody
This is a rabbit polyclonal antibody against CATSPER2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.
Product Categories/Family for anti-CATSPER2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Synonym Full Names
cation channel sperm associated 2
NCBI Official Symbol
CATSPER2
NCBI Protein Information
cation channel sperm-associated protein 2
UniProt Protein Name
Cation channel sperm-associated protein 2
UniProt Gene Name
CATSPER2
UniProt Synonym Gene Names
CatSper2
UniProt Entry Name
CTSR2_HUMAN

NCBI Description

This gene encodes a member of a family of cation channel proteins that localize to the flagellum of spermatozoa. Defects at this locus causes male infertility. Alternatively spliced transcript variants have been observed at this locus. Readthrough transcription originates upstream of this locus in diphosphoinositol pentakisphosphate kinase 1 pseudogene 1 and is represented by GeneID:110006325. Related pseudogenes are found next to this locus on chromosome 15 and on chromosome 5. [provided by RefSeq, Mar 2017]

Uniprot Description

Function: Voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte. Activated by extracellular progesterone and prostaglandins following the sequence: progesterone > PGF1-alpha = PGE1 > PGA1 > PGE2 >> PGD2. The primary effect of progesterone activation is to shift voltage dependence towards more physiological, negative membrane potentials; it is not mediated by metabotropic receptors and second messengers. Sperm capacitation enhances the effect of progesterone by providing additional negative shift. Also activated by the elevation of intracellular pH. Ref.7 Ref.8

Subunit structure: Heterotetramer; possibly composed of CATSPER1, CATSPER2, CATSPER3 and CATSPER4

Potential. Component of the CatSper complex. Interacts with Ca(v)3.3/CACNA1I, leading to suppress T-type calcium channel activity. Ref.4

Subcellular location: Cell projection › cilium › flagellum membrane; Multi-pass membrane protein

By similarity. Note: Specifically located in the principal piece of sperm tail.

Tissue specificity: Testis-specific. Ref.1 Ref.6

Involvement in disease: Deafness-infertility syndrome (DIS) [MIM:611102]: Characterized by deafness and infertility and is caused by large contiguous gene deletions at 15q15.3 that removes both STRC and CATSPER2 genes.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.3 Ref.5

Sequence similarities: Belongs to the cation channel sperm-associated (TC 1.A.1.19) family. [View classification]

Research Articles on CATSPER2

Similar Products

Product Notes

The CATSPER2 catsper2 (Catalog #AAA3202588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CATSPER2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CATSPER2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CATSPER2 catsper2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLQGLSQAVP RHTIRELLDP SRQKKLVLGD QHQLVRFSIK PQRIEQISHA. It is sometimes possible for the material contained within the vial of "CATSPER2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.