Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CASP9Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CASP9 Polyclonal Antibody | anti-CASP9 antibody

CASP9 Antibody - middle region

Gene Names
CASP9; MCH6; APAF3; APAF-3; PPP1R56; ICE-LAP6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CASP9; Polyclonal Antibody; CASP9 Antibody - middle region; anti-CASP9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSD
Sequence Length
266
Applicable Applications for anti-CASP9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CASP9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CASP9Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CASP9Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CASP9 antibody
This is a rabbit polyclonal antibody against CASP9. It was validated on Western Blot

Target Description: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CASP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
842
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
caspase-9 isoform alpha
NCBI Official Synonym Full Names
caspase 9
NCBI Official Symbol
CASP9
NCBI Official Synonym Symbols
MCH6; APAF3; APAF-3; PPP1R56; ICE-LAP6
NCBI Protein Information
caspase-9
UniProt Protein Name
Caspase-9
Protein Family
UniProt Gene Name
CASP9
UniProt Synonym Gene Names
MCH6; CASP-9; APAF-3; ICE-LAP6
UniProt Entry Name
CASP9_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Uniprot Description

CASP9: a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspase APAF1; this step is thought to be one of the earliest in the caspase activation cascade. Alternative splicing results in two isoforms.

Protein type: Apoptosis; EC 3.4.22.62; Protease

Chromosomal Location of Human Ortholog: 1p36.21

Cellular Component: mitochondrion; nucleus; cytosol; apoptosome

Molecular Function: peptidase activity; protein binding; cysteine-type endopeptidase activity; enzyme activator activity; protein kinase binding; SH3 domain binding

Biological Process: epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; apoptosis; positive regulation of apoptosis; DNA damage response, signal transduction; response to lipopolysaccharide; proteolysis; response to estradiol stimulus; response to antibiotic; DNA damage response, signal transduction resulting in induction of apoptosis; positive regulation of neuron apoptosis; response to cobalt ion; innate immune response; platelet formation; caspase activation via cytochrome c; response to DNA damage stimulus; aging

Research Articles on CASP9

Similar Products

Product Notes

The CASP9 casp9 (Catalog #AAA3219165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASP9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP9 casp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKDHGFEVAS TSPEDESPGS NPEPDATPFQ EGLRTFDQLD AISSLPTPSD. It is sometimes possible for the material contained within the vial of "CASP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.