Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescent Caspase 3 detection in HeLa cells after induction of apoptosis (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working dilution 5-15ug/ml.)

Rabbit CASP3 Polyclonal Antibody | anti-CASP3 antibody

CASP3 antibody - C-terminal region

Gene Names
CASP3; CPP32; SCA-1; CPP32B
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunofluorescence, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CASP3; Polyclonal Antibody; CASP3 antibody - C-terminal region; anti-CASP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG
Sequence Length
277
Applicable Applications for anti-CASP3 antibody
Western Blot (WB), Immunofluorescence (IF), Immunohistochemistry (IHC)
Homology
Cow: 91%; Dog: 93%; Goat: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CASP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Immunofluorescent Caspase 3 detection in HeLa cells after induction of apoptosis (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working dilution 5-15ug/ml.)

Immunofluorescence (IF) (Immunofluorescent Caspase 3 detection in HeLa cells after induction of apoptosis (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working dilution 5-15ug/ml.)
Related Product Information for anti-CASP3 antibody
This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot

Target Description: CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
Product Categories/Family for anti-CASP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
836
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
caspase-3 isoform a preproprotein
NCBI Official Synonym Full Names
caspase 3
NCBI Official Symbol
CASP3
NCBI Official Synonym Symbols
CPP32; SCA-1; CPP32B
NCBI Protein Information
caspase-3
UniProt Protein Name
Caspase-3
Protein Family
UniProt Gene Name
CASP3
UniProt Synonym Gene Names
CPP32; CASP-3; CPP-32; SCA-1
UniProt Entry Name
CASP3_HUMAN

NCBI Description

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. [provided by RefSeq, Aug 2017]

Uniprot Description

CASP3: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop- helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 17 kDa (p17) and a 12 kDa (p12) subunit. Interacts with BIRC6/bruce. Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system. Inhibited by isatin sulfonamides. Belongs to the peptidase C14A family.

Protein type: Protease; EC 3.4.22.56; Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4q34

Cellular Component: nucleoplasm; plasma membrane; nucleus; cytosol

Molecular Function: cyclin-dependent protein kinase inhibitor activity; peptidase activity; protein binding; cysteine-type endopeptidase activity; aspartic-type endopeptidase activity

Biological Process: extracellular matrix organization and biogenesis; nerve growth factor receptor signaling pathway; apoptosis; positive regulation of apoptosis; heart development; negative regulation of activated T cell proliferation; negative regulation of B cell proliferation; proteolysis; regulation of caspase activity; neuron differentiation; extracellular matrix disassembly; sensory perception of sound; B cell homeostasis; positive regulation of neuron apoptosis; response to wounding; erythrocyte differentiation; T cell homeostasis; DNA fragmentation during apoptosis; response to UV; cell structure disassembly during apoptosis; release of cytochrome c from mitochondria; cell fate commitment; negative regulation of cyclin-dependent protein kinase activity; keratinocyte differentiation; neuron apoptosis; induction of apoptosis via death domain receptors; caspase activation via cytochrome c; platelet formation; response to DNA damage stimulus; induction of apoptosis by oxidative stress; negative regulation of apoptosis

Research Articles on CASP3

Similar Products

Product Notes

The CASP3 casp3 (Catalog #AAA3214143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP3 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CASP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CASP3 casp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLKYEVRNKN DLTREEIVEL MRDVSKEDHS KRSSFVCVLL SHGEEGIIFG. It is sometimes possible for the material contained within the vial of "CASP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.