Rabbit anti-Human CASP1 Polyclonal Antibody | anti-CASP1 antibody

CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1) (Biotin)

Cat. Num. AAA6372258

• Gene Names: CASP1; ICE; P45; IL1BC
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CASP1; Polyclonal Antibody; CASP1 (Caspase-1; CASP-1; Interleukin-1 beta Convertase; IL-1BC; Interleukin-1 beta-Converting Enzyme; IL-1 beta-converting Enzyme; ICE; p45; Caspase-1 Subunit p20; Caspase-1 Subunit p10; IL1BCE; IL1BC; CASP1) (Biotin); anti-CASP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CASP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 311

• Applicable Applications for anti-CASP1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CASP1, aa1-311 (NP_150635.1).
• Immunogen Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CASP1 expression in transfected 293T cell line by CASP1 polyclonal antibody. Lane 1: CASP1 transfected lysate (35kD). Lane 2: Non-transfected lysate)

Related Product Information for anti-CASP1 antibody

CASP1 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. CASP1 was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This protein has been shown to induce cell apoptosis and may function in various developmental stages.

Product Categories/Family for anti-CASP1 antibody

Antibodies; Apoptosis; Caspase

NCBI and Uniprot Product Information

• NCBI GI #: 15431330
• NCBI GeneID: 834
• NCBI Accession #: NP_150635.1
• NCBI GenBank Nucleotide #: NM_033293
• UniProt Accession #: P29466
• NCBI Official Full Name: caspase-1 isoform gamma
• NCBI Official Synonym Full Names: caspase 1
• NCBI Official Symbol: CASP1
• NCBI Official Synonym Symbols: ICE; P45; IL1BC
• NCBI Protein Information: caspase-1
• UniProt Protein Name: Caspase-1
• UniProt Gene Name: CASP1
• UniProt Synonym Gene Names: IL1BC; IL1BCE; CASP-1; IL-1BC; ICE
• UniProt Entry Name: CASP1_HUMAN

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Mar 2012]

Uniprot Description

CASP1: Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 10 kDa (p10) subunit. The p20 subunit can also form a heterodimer with the epsilon isoform which then has an inhibitory effect. May be a component of the inflammasome, a protein complex which also includes PYCARD, CARD8 and NALP2 and whose function would be the activation of proinflammatory caspases. Interacts with CARD17/INCA and CARD18. Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain. Specifically inhibited by the cowpox virus Crma protein. Belongs to the peptidase C14A family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.36; Protease; Apoptosis

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: cytoplasm; extracellular region; cytosol

Molecular Function: protein binding; cysteine-type endopeptidase activity; endopeptidase activity; caspase activator activity

Biological Process: caspase activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; apoptosis; membrane hyperpolarization; interleukin-1 beta production; response to lipopolysaccharide; positive regulation of interleukin-1 beta secretion; mitochondrial depolarization; proteolysis; signal transduction; response to ATP; positive regulation of interleukin-1 alpha secretion; regulation of inflammatory response; response to hypoxia; innate immune response; regulation of autophagy