Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CASP1Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse CASP1 Polyclonal Antibody | anti-CASP1 antibody

CASP1 Antibody - middle region

Gene Names
Casp1; ICE; Il1bc
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CASP1; Polyclonal Antibody; CASP1 Antibody - middle region; anti-CASP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRK
Sequence Length
402
Applicable Applications for anti-CASP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CASP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CASP1Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CASP1Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CASP1 antibody
Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis (By similarity). Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive.
Product Categories/Family for anti-CASP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Full Name
caspase-1
NCBI Official Synonym Full Names
caspase 1
NCBI Official Symbol
Casp1
NCBI Official Synonym Symbols
ICE; Il1bc
NCBI Protein Information
caspase-1
UniProt Protein Name
Caspase-1
UniProt Gene Name
Casp1
UniProt Synonym Gene Names
Il1bc; CASP-1; IL-1BC; ICE; IL-1 beta-converting enzyme
UniProt Entry Name
CASP1_MOUSE

Uniprot Description

CASP1: Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 10 kDa (p10) subunit. The p20 subunit can also form a heterodimer with the epsilon isoform which then has an inhibitory effect. May be a component of the inflammasome, a protein complex which also includes PYCARD, CARD8 and NALP2 and whose function would be the activation of proinflammatory caspases. Interacts with CARD17/INCA and CARD18. Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain. Specifically inhibited by the cowpox virus Crma protein. Belongs to the peptidase C14A family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.4.22.36; Protease

Cellular Component: neuron projection; protein complex; mitochondrion; cytoplasm; extracellular region; nucleus

Molecular Function: peptidase activity; protein binding; hydrolase activity; endopeptidase activity; cysteine-type peptidase activity

Biological Process: response to drug; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of apoptosis; apoptosis; membrane hyperpolarization; microglial cell activation; interleukin-1 beta production; response to lipopolysaccharide; mitochondrial depolarization; positive regulation of interleukin-1 beta secretion; proteolysis; response to organic cyclic substance; memory; response to ATP; positive regulation of interleukin-1 alpha secretion; regulation of apoptosis; response to bacterium; regulation of inflammatory response; response to hypoxia; protein processing; regulation of autophagy; positive regulation of circadian sleep/wake cycle, non-REM sleep; myoblast fusion; positive regulation of cytokine secretion

Research Articles on CASP1

Similar Products

Product Notes

The CASP1 casp1 (Catalog #AAA3224248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CASP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP1 casp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEKDFIAFCS STPDNVSWRH PVRGSLFIES LIKHMKEYAW SCDLEDIFRK. It is sometimes possible for the material contained within the vial of "CASP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.