Caspase-1 Recombinant Protein | CASP1 recombinant protein

Recombinant Human Caspase-1

Cat. Num. AAA717132

• Gene Names: CASP1; ICE; P45; IL1BC
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Caspase-1; Recombinant Human Caspase-1; Interleukin-1 beta convertase; IL-1B; CInterleukin-1 beta-converting enzyme; ICE; IL-1 beta-converting enzyme; p45; CASP1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 120-269aa; Partial
• Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
• Sequence Length: 383

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for CASP1 recombinant protein

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis.

Product Categories/Family for CASP1 recombinant protein

Apoptosis

References

A novel heterodimeric cysteine protease is required for interleukin-1 beta processing in monocytes.Thornberry N.A., Bull H.G., Calaycay J.R., Chapman K.T., Howard A.D., Kostura M.J., Miller D.K., Molineaux S.M., Weidner J.R., Aunins J., Elliston K.O., Ayala J.M., Casano F.J., Chin J., Ding G.J.-F., Egger L.A., Gaffney E.P., Limjuco G., Palyha O.C., Raju M., Rolando A.M., Salley J.P., Yamin T.-T., Lee T.D., Shively J.E., McCross M., Mumford R.A., Schmidt J.A., Tocci M.J.Nature 356:768-774(1992) Molecular cloning of the interleukin-1 beta converting enzyme.Cerretti D.P., Kozlosky C.J., Mosley B., Nelson N., van Ness K., Greenstreet T.A., March C.J., Kronheim S.R., Druck T., Cannizzaro L.A., Huebner K., Black R.A.Science 256:97-100(1992) Cloning and expression of four novel isoforms of human interleukin-1 beta converting enzyme with different apoptotic activities.Alnemri E.S., Fernandes-Alnemri T., Litwack G.J. Biol. Chem. 270:4312-4317(1995) Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) Caspase-1 zeta, a new splice variant of caspase-1 gene.Feng Q., Li P., Leung P.C.K., Auersperg N.Genomics 84:587-591(2004) Purification of interleukin-1 beta converting enzyme, the protease that cleaves the interleukin-1 beta precursor.Kronheim S.R., Mumma A., Greenstreet T., Glackin P.J., Van Ness K., March C.J., Black R.A.Arch. Biochem. Biophys. 296:698-703(1992) ICEBERG a novel inhibitor of interleukin-1beta generation.Humke E.W., Shriver S.K., Starovasnik M.A., Fairbrother W.J., Dixit V.M.Cell 103:99-111(2000) NALP3 forms an IL-1beta-processing inflammasome with increased activity in Muckle-Wells autoinflammatory disorder.Agostini L., Martinon F., Burns K., McDermott M.F., Hawkins P.N., Tschopp J.Immunity 20:319-325(2004) INCA, a novel human caspase recruitment domain protein that inhibits interleukin-1beta generation.Lamkanfi M., Denecker G., Kalai M., D'hondt K., Meeus A., Declercq W., Saelens X., Vandenabeele P.J. Biol. Chem. 279:51729-51738(2004) The B30.2 domain of pyrin, the familial Mediterranean fever protein, interacts directly with caspase-1 to modulate IL-1beta production.Chae J.J., Wood G., Masters S.L., Richard K., Park G., Smith B.J., Kastner D.L.Proc. Natl. Acad. Sci. U.S.A. 103:9982-9987(2006) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Crystal structure of the cysteine protease interleukin-1 beta-converting enzyme a (p20/p10) 2 homodimer.Walker N.P.C., Talanian R.V., Brady K.D., Dang L.C., Bump N.J., Ferenz C.R., Franklin S., Ghayur T., Hackett M.C., Hammill L.D., Herzog L., Hugunin M., Houy W., Mankovich J.A., McGuiness L., Orlewicz E., Paskind M., Pratt C.A., Reis P., Summani A., Terranova M., Welch J.P., Xiong L., Moeller A., Tracey D.E., Kamen R., Wong W.W.Cell 78:343-352(1994) A combinatorial approach for determining protease specificities application to interleukin-1beta converting enzyme (ICE) .Rano T.A., Timkey T., Peterson E.P., Rotonda J., Nicholson D.W., Becker J.W., Chapman K.T., Thornberry N.A.Chem. Biol. 4:149-155(1997) Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.Okamoto Y., Anan H., Nakai E., Morihira K., Yonetoku Y., Kurihara H., Sakashita H., Terai Y., Takeuchi M., Shibanuma T., Isomura Y.Chem. Pharm. Bull. 47:11-21(1999) Crystal structures of a ligand-free and malonate-bound human caspase-1 implications for the mechanism of substrate binding.Romanowski M.J., Scheer J.M., O'Brien T., McDowell R.S.Structure 12:1361-1371(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 4502573
• NCBI GeneID: 834
• NCBI Accession #: NP_001214.1
• NCBI GenBank Nucleotide #: NM_001223.4
• UniProt Accession #: P29466; Q53EY6; Q6DMQ1; Q6GSS3; Q6PI75; Q9UCN3; B5MDZ1
• Molecular Weight: 44.2kD
• NCBI Official Full Name: caspase-1 isoform beta
• NCBI Official Synonym Full Names: caspase 1
• NCBI Official Symbol: CASP1
• NCBI Official Synonym Symbols: ICE; P45; IL1BC
• NCBI Protein Information: caspase-1
• UniProt Protein Name: Caspase-1
• Protein Family: Caspase
• UniProt Gene Name: CASP1
• UniProt Synonym Gene Names: IL1BC; IL1BCE; CASP-1; IL-1BC; ICE; IL-1 beta-converting enzyme
• UniProt Entry Name: CASP1_HUMAN

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Mar 2012]

Uniprot Description

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis.