Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CASKSample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CASK Polyclonal Antibody | anti-CASK antibody

CASK Antibody - middle region

Gene Names
CASK; CMG; FGS4; LIN2; TNRC8; hCASK; CAGH39; CAMGUK; MICPCH; MRXSNA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CASK; Polyclonal Antibody; CASK Antibody - middle region; anti-CASK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHE
Sequence Length
897
Applicable Applications for anti-CASK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CASK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CASKSample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CASKSample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CASK antibody
This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, mental retardation and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98 kDa
NCBI Official Full Name
Peripheral plasma membrane protein CASK
NCBI Official Synonym Full Names
calcium/calmodulin dependent serine protein kinase
NCBI Official Symbol
CASK
NCBI Official Synonym Symbols
CMG; FGS4; LIN2; TNRC8; hCASK; CAGH39; CAMGUK; MICPCH; MRXSNA
NCBI Protein Information
peripheral plasma membrane protein CASK
UniProt Protein Name
Peripheral plasma membrane protein CASK
Protein Family
UniProt Gene Name
CASK
UniProt Synonym Gene Names
LIN2; hCASK
UniProt Entry Name
CSKP_HUMAN

NCBI Description

This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, intellectual disability and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked intellectual disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017]

Uniprot Description

CASK: a MAGUK family protein and a protein kinase of the CAMK group. Contains one protein kinase domain, one guanylate kinase domain, two L27 domains, one PDZ domain and one SH3 domain. Plays a role in synaptic transmembrane protein anchoring and ion channel trafficking. Contributes to neural development and regulation of gene expression via interaction with the transcription factor TRB1. Binds to cell-surface proteins, including amyloid precursor protein, neurexins and syndecans. May mediate a link between the extracellular matrix and the actin cytoskeleton via its interaction with syndecan and with the actin/spectrin-binding protein 4.1. Lacks the canonical DFG motif required for Mg++ binding, but retains protein kinase activity even without binding Mg++. Six alternatively spliced human isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Adaptor/scaffold; EC 2.7.11.1; Protein kinase, CAMK; CAMK group; CASK family

Chromosomal Location of Human Ortholog: Xp11.4

Cellular Component: presynaptic membrane; nuclear lamina; focal adhesion; nuclear matrix; basolateral plasma membrane; cytoplasm; plasma membrane; nucleolus; basement membrane; intercellular junction; cytosol; actin cytoskeleton

Molecular Function: calmodulin binding; guanylate kinase activity; protein serine/threonine kinase activity; protein binding; neurexin binding; ATP binding

Biological Process: extracellular matrix organization and biogenesis; positive regulation of transcription from RNA polymerase II promoter; cell adhesion; negative regulation of cell-matrix adhesion; protein amino acid phosphorylation; nucleotide phosphorylation

Disease: Mental Retardation And Microcephaly With Pontine And Cerebellar Hypoplasia; Fg Syndrome 4

Research Articles on CASK

Similar Products

Product Notes

The CASK cask (Catalog #AAA3221580) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASK Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASK cask for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HPDRFAYPIP HTTRPPKKDE ENGKNYYFVS HDQMMQDISN NEYLEYGSHE. It is sometimes possible for the material contained within the vial of "CASK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.