Western Blot (WB)
(Host: RabbitTarget Name: CASC4Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human, Mouse CASC4 Polyclonal Antibody | anti-CASC4 antibody
CASC4 Antibody - middle region
Gene Names
CASC4; H63
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CASC4; Polyclonal Antibody; CASC4 Antibody - middle region; anti-CASC4 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV
Sequence Length
380
Applicable Applications for anti-CASC4 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CASC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CASC4Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CASC4Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CASC4 antibody
This is a rabbit polyclonal antibody against CASC4. It was validated on Western Blot
Target Description: The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Alternatively spliced variants encoding different isoforms have been identified for this gene.
Target Description: The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Alternatively spliced variants encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-CASC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43kDa
NCBI Official Full Name
protein CASC4 isoform b
NCBI Official Synonym Full Names
cancer susceptibility 4
NCBI Official Symbol
CASC4
NCBI Official Synonym Symbols
H63
NCBI Protein Information
protein CASC4
Protein Family
NCBI Description
The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Alternatively spliced variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Dec 2010]
Research Articles on CASC4
Similar Products
Product Notes
The CASC4 (Catalog #AAA3218111) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASC4 Antibody - middle region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CASC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASC4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQCGQQMKEL RAQHEENIKK LADQFLEEQK QETQKIQSND GKELDINNQV. It is sometimes possible for the material contained within the vial of "CASC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
