Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAPRIN2Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlCAPRIN2 is supported by BioGPS gene expression data to be expressed in A549)

Rabbit CAPRIN2 Polyclonal Antibody | anti-CAPRIN2 antibody

CAPRIN2 Antibody - N-terminal region

Gene Names
CAPRIN2; EEG1; EEG-1; C1QDC1; RNG140
Reactivity
Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPRIN2; Polyclonal Antibody; CAPRIN2 Antibody - N-terminal region; anti-CAPRIN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASP
Sequence Length
278
Applicable Applications for anti-CAPRIN2 antibody
Western Blot (WB)
Homology
Dog: 93%; Horse: 92%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPRIN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAPRIN2Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlCAPRIN2 is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (Host: RabbitTarget Name: CAPRIN2Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlCAPRIN2 is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-CAPRIN2 antibody
This is a rabbit polyclonal antibody against CAPRIN2. It was validated on Western Blot

Target Description: The protein encoded by this gene may be involved in the transitioning of erythroblasts from a highly proliferative state to a terminal phase of differentiation. High level expression of the encoded protein can lead to apoptosis. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CAPRIN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
CAPRIN2 protein
NCBI Official Synonym Full Names
caprin family member 2
NCBI Official Symbol
CAPRIN2
NCBI Official Synonym Symbols
EEG1; EEG-1; C1QDC1; RNG140
NCBI Protein Information
caprin-2
UniProt Protein Name
Caprin-2
Protein Family
UniProt Gene Name
CAPRIN2
UniProt Entry Name
CAPR2_HUMAN

NCBI Description

The protein encoded by this gene may regulate the transport of mRNA. It may play a role in the differentiation of erythroblasts. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Uniprot Description

C1QDC1: May regulate the transport and translation of mRNAs, modulating for instance the expression of proteins involved in synaptic plasticity in neurons. Involved in regulation of growth as erythroblasts shift from a highly proliferative state towards their terminal phase of differentiation. May be involved in apoptosis. Belongs to the caprin family. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 12p11

Cellular Component: centrosome; cytoplasm; mitochondrion; nucleus; receptor complex

Molecular Function: protein binding; receptor binding; RNA binding

Biological Process: negative regulation of cell growth; negative regulation of translation; positive regulation of dendrite morphogenesis; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein binding; positive regulation of transcription from RNA polymerase II promoter

Research Articles on CAPRIN2

Similar Products

Product Notes

The CAPRIN2 caprin2 (Catalog #AAA3217331) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPRIN2 Antibody - N-terminal region reacts with Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CAPRIN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPRIN2 caprin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGYQSPSGHS EEEREGNMKS AKPQVNHSQH GESQRALSPL QSTLSSAASP. It is sometimes possible for the material contained within the vial of "CAPRIN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.