Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAPGSample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CAPG Polyclonal Antibody | anti-CAPG antibody

CAPG Antibody - N-terminal region

Gene Names
CAPG; MCP; AFCP; HEL-S-66
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CAPG; Polyclonal Antibody; CAPG Antibody - N-terminal region; anti-CAPG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVL
Sequence Length
167
Applicable Applications for anti-CAPG antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAPG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAPGSample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CAPGSample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CAPG antibody
This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed for this gene.
Product Categories/Family for anti-CAPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
822
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
macrophage-capping protein isoform 1
NCBI Official Synonym Full Names
capping actin protein, gelsolin like
NCBI Official Symbol
CAPG
NCBI Official Synonym Symbols
MCP; AFCP; HEL-S-66
NCBI Protein Information
macrophage-capping protein
UniProt Protein Name
Macrophage-capping protein
Protein Family
UniProt Gene Name
CAPG
UniProt Synonym Gene Names
AFCP; MCP
UniProt Entry Name
CAPG_HUMAN

NCBI Description

This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

CAPG: Calcium-sensitive protein which reversibly blocks the barbed ends of actin filaments but does not sever preformed actin filaments. May play an important role in macrophage function. May play a role in regulating cytoplasmic and/or nuclear structures through potential interactions with actin. May bind DNA. Belongs to the villin/gelsolin family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: F-actin capping protein complex; melanosome; nucleus

Molecular Function: actin binding

Biological Process: protein complex assembly; cell projection biogenesis; barbed-end actin filament capping

Research Articles on CAPG

Similar Products

Product Notes

The CAPG capg (Catalog #AAA3220188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPG Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPG capg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YTAIPQSGSP FPGSVQDPGL HVWRVEKLKP VPVAQENQGV FFSGDSYLVL. It is sometimes possible for the material contained within the vial of "CAPG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.