Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAP2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit CAP2 Polyclonal Antibody | anti-CAP2 antibody

CAP2 antibody - C-terminal region

Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAP2; Polyclonal Antibody; CAP2 antibody - C-terminal region; anti-CAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPS
Sequence Length
477
Applicable Applications for anti-CAP2 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Yeast: 81%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAP2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-CAP2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-CAP2 antibody
This is a rabbit polyclonal antibody against CAP2. It was validated on Western Blot

Target Description: This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein and actin.
Product Categories/Family for anti-CAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
adenylyl cyclase-associated protein 2 isoform 1
NCBI Official Synonym Full Names
cyclase associated actin cytoskeleton regulatory protein 2
NCBI Official Symbol
CAP2
NCBI Protein Information
adenylyl cyclase-associated protein 2
UniProt Protein Name
Adenylyl cyclase-associated protein 2
Protein Family
UniProt Gene Name
CAP2
UniProt Synonym Gene Names
CAP 2
UniProt Entry Name
CAP2_HUMAN

NCBI Description

This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein and actin. [provided by RefSeq, Jul 2008]

Uniprot Description

CAP2: a cyclase-associated protein. CAPs are evolutionarily conserved proteins with roles in regulating the actin cytoskeleton and in signal transduction. CAP2 is expressed mainly in brain, heart and skeletal muscle, and skin. It is found in the nucleus in undifferentiated myoblasts and at the M-line of differentiated myotubes. Up-regulated in human cancers. May play a role in multistage hepatocarcinogenesis.

Protein type: Actin-binding

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: plasma membrane

Molecular Function: actin binding

Biological Process: axon guidance; adenylate cyclase activation; establishment and/or maintenance of cell polarity; cytoskeleton organization and biogenesis; signal transduction

Research Articles on CAP2

Similar Products

Product Notes

The CAP2 cap2 (Catalog #AAA3216195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAP2 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's CAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAP2 cap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPPPLFENEG KKEESSPSRS ALFAQLNQGE AITKGLRHVT DDQKTYKNPS. It is sometimes possible for the material contained within the vial of "CAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.