Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CANT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Rabbit CANT1 Polyclonal Antibody | anti-CANT1 antibody

CANT1 antibody - middle region

Gene Names
CANT1; DBQD; EDM7; DBQD1; SCAN1; SHAPY; SCAN-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CANT1; Polyclonal Antibody; CANT1 antibody - middle region; anti-CANT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
Sequence Length
401
Applicable Applications for anti-CANT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CANT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CANT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-CANT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Related Product Information for anti-CANT1 antibody
This is a rabbit polyclonal antibody against CANT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP. And it does not hydrolyze AMP and GMP.
Product Categories/Family for anti-CANT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
soluble calcium-activated nucleotidase 1
NCBI Official Synonym Full Names
calcium activated nucleotidase 1
NCBI Official Symbol
CANT1
NCBI Official Synonym Symbols
DBQD; EDM7; DBQD1; SCAN1; SHAPY; SCAN-1
NCBI Protein Information
soluble calcium-activated nucleotidase 1
UniProt Protein Name
Soluble calcium-activated nucleotidase 1
UniProt Gene Name
CANT1
UniProt Synonym Gene Names
SHAPY; SCAN-1
UniProt Entry Name
CANT1_HUMAN

NCBI Description

This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies. Alternatively spliced transcript variants have been noted for this gene.[provided by RefSeq, Mar 2010]

Uniprot Description

CANT1: Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP. Involved in proteoglycan synthesis. Defects in CANT1 are the cause of Desbuquois dysplasia (DBQD). A chondrodysplasia characterized by severe prenatal and postnatal growth retardation (less than -5 SD), joint laxity, short extremities, progressive scoliosis, round face, midface hypoplasia, prominent bulging eyes. The main radiologic features are short long bones with metaphyseal splay, a 'Swedish key' appearance of the proximal femur (exaggerated trochanter), and advance carpal and tarsal bone age. Two forms of Desbuquois dysplasia are distinguished on the basis of the presence (type 1) or absence (type 2) of characteristic hand anomalies: an extra ossification center distal to the second metacarpal, delta phalanx, bifid distal thumb phalanx, and phalangeal dislocations. Belongs to the apyrase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Endoplasmic reticulum; Membrane protein, integral; EC 3.6.1.6

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: signal transducer activity; calcium ion binding; uridine-diphosphatase activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; proteoglycan biosynthetic process; signal transduction

Disease: Desbuquois Dysplasia 1

Research Articles on CANT1

Similar Products

Product Notes

The CANT1 cant1 (Catalog #AAA3210896) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CANT1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CANT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CANT1 cant1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPDFGDIAVS HVGAVVPTHG FSSFKFIPNT DDQIIVALKS EEDSGRVASY. It is sometimes possible for the material contained within the vial of "CANT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.