Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CAND2 Polyclonal Antibody)

Rabbit CAND2 Polyclonal Antibody | anti-CAND2 antibody

CAND2 Polyclonal Antibody

Gene Names
CAND2; Tp120b; TIP120B
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CAND2; Polyclonal Antibody; CAND2 Polyclonal Antibody; TIP120B; Tp120b; cullin-associated NEDD8-dissociated protein 2; anti-CAND2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.39 mg/ml (varies by lot)
Sequence Length
1119
Applicable Applications for anti-CAND2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1).
Immunogen Sequence
VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD
Positive Samples
HeLa, 293T, Jurkat, NIH/3T3, Mouse Heart, Rat Heart
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CAND2 Polyclonal Antibody)

Western Blot (WB) (Western blot-CAND2 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 122kDa; 135kDa
Observed: 130kDa
NCBI Official Full Name
cullin-associated NEDD8-dissociated protein 2 isoform 2
NCBI Official Synonym Full Names
cullin associated and neddylation dissociated 2 (putative)
NCBI Official Symbol
CAND2
NCBI Official Synonym Symbols
Tp120b; TIP120B
NCBI Protein Information
cullin-associated NEDD8-dissociated protein 2
UniProt Protein Name
Cullin-associated NEDD8-dissociated protein 2
UniProt Gene Name
CAND2
UniProt Synonym Gene Names
KIAA0667; TIP120B; TBP-interacting protein 120B
UniProt Entry Name
CAND2_HUMAN

Uniprot Description

CAND2: May play a role in the assembly of ubiquitin ligase complexes and modulate the ubiquitination of target proteins. May be a transcription regulator (Potential). Belongs to the CAND family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p25.2

Cellular Component: intracellular; nucleus

Molecular Function: protein binding; TATA-binding protein binding

Biological Process: transcription, DNA-dependent; SCF complex assembly; positive regulation of transcription, DNA-dependent; protein ubiquitination

Research Articles on CAND2

Similar Products

Product Notes

The CAND2 cand2 (Catalog #AAA9140884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAND2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAND2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CAND2 cand2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAND2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.