Western Blot (WB)
(WB Suggested Anti-CAMKV Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Rabbit CAMKV Polyclonal Antibody | anti-CAMKV antibody
CAMKV antibody - N-terminal region
Gene Names
CAMKV; 1G5; VACAMKL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAMKV; Polyclonal Antibody; CAMKV antibody - N-terminal region; anti-CAMKV antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF
Sequence Length
501
Applicable Applications for anti-CAMKV antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKV
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CAMKV Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-CAMKV Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Related Product Information for anti-CAMKV antibody
This is a rabbit polyclonal antibody against CAMKV. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CAMKV does not appear to have detectable kinase activity.
Target Description: CAMKV does not appear to have detectable kinase activity.
Product Categories/Family for anti-CAMKV antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
caM kinase-like vesicle-associated protein isoform 1
NCBI Official Synonym Full Names
CaM kinase like vesicle associated
NCBI Official Symbol
CAMKV
NCBI Official Synonym Symbols
1G5; VACAMKL
NCBI Protein Information
caM kinase-like vesicle-associated protein
UniProt Protein Name
CaM kinase-like vesicle-associated protein
Protein Family
UniProt Gene Name
CAMKV
UniProt Entry Name
CAMKV_HUMAN
Uniprot Description
VACAMKL: Does not appear to have detectable kinase activity. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; Kinase, protein; CAMK group; CAMK-Unique family
Chromosomal Location of Human Ortholog: 3p21.31
Cellular Component: cytoplasmic vesicle membrane; plasma membrane
Molecular Function: calmodulin binding; ATP binding; protein kinase activity
Biological Process: protein amino acid phosphorylation
Research Articles on CAMKV
Similar Products
Product Notes
The CAMKV camkv (Catalog #AAA3213975) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMKV antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAMKV can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMKV camkv for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRWLQSTNDS RFGHFRLSSG KFYGHKEKDK GLQTTQNGRF YAISARFKPF. It is sometimes possible for the material contained within the vial of "CAMKV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
