Western Blot (WB)
(WB Suggested Anti-Caly Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Lung)
Rabbit Caly Polyclonal Antibody | anti-CALY antibody
Caly antibody - middle region
Gene Names
Caly; Drd1ip; Calcyon
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Caly; Polyclonal Antibody; Caly antibody - middle region; anti-CALY antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA
Sequence Length
226
Applicable Applications for anti-CALY antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Caly Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Lung)
Western Blot (WB)
(WB Suggested Anti-Caly Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Lung)
Related Product Information for anti-CALY antibody
This is a rabbit polyclonal antibody against Caly. It was validated on Western Blot
Target Description: Caly interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.
Target Description: Caly interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.
Product Categories/Family for anti-CALY antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
neuron-specific vesicular protein calcyon
NCBI Official Synonym Full Names
calcyon neuron-specific vesicular protein
NCBI Official Symbol
Caly
NCBI Official Synonym Symbols
Drd1ip; Calcyon
NCBI Protein Information
neuron-specific vesicular protein calcyon
UniProt Protein Name
Neuron-specific vesicular protein calcyon
Protein Family
UniProt Gene Name
Caly
UniProt Synonym Gene Names
Drd1ip
UniProt Entry Name
CALY_RAT
NCBI Description
dopamine receptor 1 (D1R) of D1-like receptors interacting protein [RGD, Feb 2006]
Research Articles on CALY
Similar Products
Product Notes
The CALY caly (Catalog #AAA3208461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Caly antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Caly can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CALY caly for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RHRSILAAIG AYPLSRKHGT EMPAIWGNSY RAGKEEHKGT TPAAMTVSTA. It is sometimes possible for the material contained within the vial of "Caly, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
