Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CALR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CALR Polyclonal Antibody | anti-CALR antibody

CALR Antibody - N-terminal region

Gene Names
CALR; RO; CRT; SSA; cC1qR; HEL-S-99n
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CALR; Polyclonal Antibody; CALR Antibody - N-terminal region; anti-CALR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ
Sequence Length
417
Applicable Applications for anti-CALR antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CALR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CALR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-CALR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ThyroidObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CALR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ThyroidObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: CALRSample Type: 721_B Whole cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that CALR is expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: CALRSample Type: 721_B Whole cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that CALR is expressed in 721_B)
Related Product Information for anti-CALR antibody
This is a rabbit polyclonal antibody against CALR. It was validated on Western Blot

Target Description: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
811
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
calreticulin
NCBI Official Synonym Full Names
calreticulin
NCBI Official Symbol
CALR
NCBI Official Synonym Symbols
RO; CRT; SSA; cC1qR; HEL-S-99n
NCBI Protein Information
calreticulin
UniProt Protein Name
Calreticulin
Protein Family
UniProt Gene Name
CALR
UniProt Synonym Gene Names
CRTC; ERp60
UniProt Entry Name
CALR_HUMAN

NCBI Description

Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin but calreticulin is not a Ro/SS-A antigen. Earlier papers referred to calreticulin as an Ro/SS-A antigen but this was later disproven. Increased autoantibody titer against human calreticulin is found in infants with complete congenital heart block of both the IgG and IgM classes. [provided by RefSeq, Jul 2008]

Uniprot Description

Calreticulin: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Monomer. Component of an EIF2 complex at least composed of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1 and HSPA5. Interacts with PDIA3/ERp57. Interacts with NR3C1 and TRIM21. Interacts with GABARAP. Belongs to the calreticulin family.

Protein type: Secreted, signal peptide; Secreted; Nuclear receptor co-regulator; Calcium-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: Golgi apparatus; extracellular space; smooth endoplasmic reticulum; sarcoplasmic reticulum lumen; cell surface; focal adhesion; endoplasmic reticulum lumen; endoplasmic reticulum; extracellular region; acrosome; cytosol; polysome; proteinaceous extracellular matrix; membrane; perinuclear region of cytoplasm; cytoplasm; intracellular; nucleus; external side of plasma membrane

Molecular Function: hormone binding; zinc ion binding; complement component C1q binding; unfolded protein binding; calcium ion binding; peptide binding; mRNA binding; integrin binding; protein binding; androgen receptor binding; DNA binding; ubiquitin protein ligase binding; iron ion binding; chaperone binding; glycoprotein binding; carbohydrate binding

Biological Process: protein maturation via protein folding; protein folding; regulation of meiosis; negative regulation of transcription from RNA polymerase II promoter; cardiac muscle cell differentiation; response to estradiol stimulus; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of transcription, DNA-dependent; positive regulation of phagocytosis; positive regulation of cell proliferation; antigen processing and presentation of exogenous peptide antigen via MHC class I; protein export from nucleus; cortical actin cytoskeleton organization and biogenesis; cell cycle arrest; response to drug; receptor-mediated endocytosis; negative regulation of steroid hormone receptor signaling pathway; protein stabilization; unfolded protein response; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; positive regulation of cell cycle; response to testosterone stimulus; post-translational protein modification; peptide antigen assembly with MHC class I protein complex; cellular calcium ion homeostasis; negative regulation of retinoic acid receptor signaling pathway; negative regulation of neuron differentiation; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; sequestering of calcium ion; negative regulation of translation; glucocorticoid receptor signaling pathway; protein amino acid N-linked glycosylation via asparagine; spermatogenesis; negative regulation of transcription, DNA-dependent; positive regulation of DNA replication

Disease: Myelofibrosis; Thrombocythemia 1

Research Articles on CALR

Similar Products

Product Notes

The CALR calr (Catalog #AAA3213750) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALR Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CALR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CALR calr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSGKFYGDEE KDKGLQTSQD ARFYALSASF EPFSNKGQTL VVQFTVKHEQ. It is sometimes possible for the material contained within the vial of "CALR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.