Mouse anti-Human CALML3 Polyclonal Antibody | anti-CALML3 antibody

CALML3 (Calmodulin-like Protein 3, CaM-like Protein, CLP, Calmodulin-related Protein NB-1)

Cat. Num. AAA646969

• Gene Names: CALML3; CLP
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CALML3; Polyclonal Antibody; CALML3 (Calmodulin-like Protein 3; CaM-like Protein; CLP; Calmodulin-related Protein NB-1); Anti -CALML3 (Calmodulin-like Protein 3; anti-CALML3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CALML3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

• Applicable Applications for anti-CALML3 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human CALML3, aa1-149 (NP_005176.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CALML3 polyclonal antibody. Western Blot analysis of CALML3 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of CALML3 expression in transfected 293T cell line by CALML3 polyclonal antibody. Lane 1: CALML3 transfected lysate (16.39kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to CALML3 on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-CALML3 antibody

May be similar to that of authentic calmodulin and may actually compete with calmodulin by binding, with different affinities, to cellular substrates.

Product Categories/Family for anti-CALML3 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4885111
• NCBI GeneID: 810
• NCBI Accession #: NP_005176.1
• NCBI GenBank Nucleotide #: NM_005185.2
• UniProt Accession #: P27482; Q5SQI4; B2R9V6
• Molecular Weight: 16,891 Da
• NCBI Official Full Name: calmodulin-like protein 3
• NCBI Official Synonym Full Names: calmodulin-like 3
• NCBI Official Symbol: CALML3
• NCBI Official Synonym Symbols: CLP
• NCBI Protein Information: calmodulin-like protein 3; caM-like protein; calmodulin-related protein NB-1
• UniProt Protein Name: Calmodulin-like protein 3
• Protein Family: Calmodulin-like protein
• UniProt Gene Name: CALML3
• UniProt Synonym Gene Names: CLP
• UniProt Entry Name: CALL3_HUMAN

Uniprot Description

Function: May be similar to that of authentic calmodulin and may actually compete with calmodulin by binding, with different affinities, to cellular substrates.

Tissue specificity: Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells. Ref.1

Induction: By TGFB1. Ref.1

Miscellaneous: Binds four calcium ions.

Sequence similarities: Belongs to the calmodulin family.Contains 4 EF-hand domains.