Western Blot (WB)
(WB Suggested Anti-FAM26F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Rabbit CALHM6 Polyclonal Antibody | anti-CALHM6 antibody
CALHM6 Antibody - middle region
Gene Names
CALHM6; INAM; FAM26F; C6orf187; dJ93H18.5
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CALHM6; Polyclonal Antibody; CALHM6 Antibody - middle region; anti-CALHM6 antibody
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIF
Sequence Length
315
Applicable Applications for anti-CALHM6 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 92%;
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FAM26F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FAM26F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-FAM26F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-CALHM6 antibody
This is a rabbit polyclonal antibody against FAM26F. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-CALHM6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
calcium homeostasis modulator protein 6 isoform 1
NCBI Official Synonym Full Names
calcium homeostasis modulator family member 6
NCBI Official Symbol
CALHM6
NCBI Official Synonym Symbols
INAM; FAM26F; C6orf187; dJ93H18.5
NCBI Protein Information
calcium homeostasis modulator protein 6
UniProt Protein Name
Protein FAM26F
UniProt Gene Name
FAM26F
UniProt Synonym Gene Names
C6orf187
UniProt Entry Name
FA26F_HUMAN
Uniprot Description
FAM26F: Belongs to the FAM26 family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 6q22.1
Cellular Component: integral to plasma membrane
Molecular Function: cation channel activity
Biological Process: cation transport
Research Articles on CALHM6
Similar Products
Product Notes
The CALHM6 fam26f (Catalog #AAA3207452) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALHM6 Antibody - middle region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CALHM6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CALHM6 fam26f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRSCAAELPL VPCNQAKASD VQDLLKDLKA QSQVLGWILI AVVIIILLIF. It is sometimes possible for the material contained within the vial of "CALHM6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
