Goat anti-Human Calcitonin-Gene related Peptide 2 Polyclonal Antibody | anti-CALCB antibody
Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2)
Gene Names
CALCB; CALC2; CGRP2; CGRP-II; FLJ30166
Reactivity
Human
Applications
immunoassay, Radioimmunoassay
Purity
SerumSerum
Synonyms
Calcitonin-Gene related Peptide 2; Polyclonal Antibody; Calcitonin-Gene related Peptide 2 (CGRP-II; Beta-ype CGRP; CALCB; CALC2); Anti -Calcitonin-Gene related Peptide 2 (CGRP-II; anti-CALCB antibody
Host
Goat
Reactivity
Human
Clonality
Polyclonal
Specificity
Recognizes human Calcitonin-Gene related Peptide 2. There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute with sterile dH2O.
Applicable Applications for anti-CALCB antibody
Radioimmunoassay (RIA)
Application Notes
Suitable for use in RIA.
Dilution: RIA: 1:3000
Dilution: RIA: 1:3000
Immunogen
Synthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF)
Preparation and Storage
Lyophilized powder may be stored at 4 degree C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Product Categories/Family for anti-CALCB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,706 Da
NCBI Official Full Name
calcitonin gene-related peptide 2
NCBI Official Synonym Full Names
calcitonin-related polypeptide beta
NCBI Official Symbol
CALCB
NCBI Official Synonym Symbols
CALC2; CGRP2; CGRP-II; FLJ30166
NCBI Protein Information
calcitonin gene-related peptide 2; beta-CGRP; calcitonin 2; beta-type CGRP; OTTHUMP00000227061; OTTHUMP00000231700; calcitonin gene-related peptide II
UniProt Protein Name
Calcitonin gene-related peptide 2
Protein Family
UniProt Gene Name
CALCB
UniProt Synonym Gene Names
CALC2
UniProt Entry Name
CALCB_HUMAN
Uniprot Description
CALCB: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. Belongs to the calcitonin family.
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 11p15.2-p15.1
Cellular Component: extracellular region
Molecular Function: neuropeptide hormone activity
Biological Process: cellular calcium ion homeostasis; signal transduction
Research Articles on CALCB
Similar Products
Product Notes
The CALCB calcb (Catalog #AAA620915) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. The Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Calcitonin-Gene related Peptide 2 can be used in a range of immunoassay formats including, but not limited to, Radioimmunoassay (RIA). Suitable for use in RIA. Dilution: RIA: 1:3000. Researchers should empirically determine the suitability of the CALCB calcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Calcitonin-Gene related Peptide 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
