Immunohistochemistry (IHC)
(Figure 1. IHC analysis of Calcitonin using anti-Calcitonin antibody.Calcitonin was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/mL rabbit anti-Calcitonin Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
Rabbit Calcitonin/Calca Polyclonal Antibody | anti-Calca antibody
Anti-Calcitonin/Calca Antibody
Gene Names
Calca; CA; Ct; Ctn; Calc; Cgrp; CGRP1; Calc1; CGRP-1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
Calcitonin/Calca; Polyclonal Antibody; Anti-Calcitonin/Calca Antibody; Calcitonin; Calca; Calc; Calcitonin-related polypeptide; alpha; anti-Calca antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
128
Applicable Applications for anti-Calca antibody
Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Immunogen
A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Immunohistochemistry (IHC)
(Figure 1. IHC analysis of Calcitonin using anti-Calcitonin antibody.Calcitonin was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/mL rabbit anti-Calcitonin Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
Immunohistochemistry (IHC)
(Figure 1. IHC analysis of Calcitonin using anti-Calcitonin antibody.Calcitonin was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/mL rabbit anti-Calcitonin Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
Related Product Information for anti-Calca antibody
Description: Rabbit IgG polyclonal antibody for Calcitonin detection. Tested with IHC-P in Human; Mouse; Rat.
Background: Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
Background: Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. Alevizaki, M., Stevenson, J. C., Girgis, S. I., MacIntyre, I., Legon, S. Altered calcitonin gene in a young patient with osteoporosis.Brit. Med. J. 298: 1215-1216, 1989. Note: Retraction: Brit. Med. J. 299: 235 only, 1989. 2. Breimer, L. H., MacIntyre, I., Zaidi, M. Peptides from the calcitonin genes: molecular genetics, structure and function. Biochem. J. 255: 377-390, 1988. 3. Edbrooke, M. R., Parker, D., McVey, J. H., Riley, J. H., Sorenson, G. D., Pettengill, O. S., Craig, R. K. Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma. EMBO J. 4: 715-724, 1985.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,065 Da
NCBI Official Full Name
calcitonin gene-related peptide 1 isoform Calca preproprotein
NCBI Official Synonym Full Names
calcitonin/calcitonin-related polypeptide, alpha
NCBI Official Symbol
Calca
NCBI Official Synonym Symbols
CA; Ct; Ctn; Calc; Cgrp; CGRP1; Calc1; CGRP-1
NCBI Protein Information
calcitonin gene-related peptide 1
UniProt Protein Name
Calcitonin
Protein Family
UniProt Gene Name
Calca
UniProt Synonym Gene Names
Calc
NCBI Description
This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide (CGRP) and katacalcin. Alternative splicing of the mRNA results in multiple variants that encode either calcitonin or CGRP preproproteins. Post-translational processing of the calcitonin and CGRP propeptides results in either calcitonin and katacalcin, or CGRP, respectively. Calcitonin and katacalcin modulate calcium levels in the blood stream. CGRP can function as a vasodilator and play a role in the transmission of pain. The human homolog of CGRP was found to have antimicrobial activity. [provided by RefSeq, Mar 2015]
Uniprot Description
Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Research Articles on Calca
Similar Products
Product Notes
The Calca calca (Catalog #AAA1751418) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Calcitonin/Calca Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Calcitonin/Calca can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC) Paraffin. IHC-P: 0.5-1 mug/ml Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Researchers should empirically determine the suitability of the Calca calca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Calcitonin/Calca, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
