Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CA12 rabbit polyclonal antibody. Western Blot analysis of CA12 expression in MCF-7.)

Rabbit anti-Human CA12 Polyclonal Antibody | anti-CA12 antibody

CA12 (Carbonic Anhydrase 12, Carbonate Dehydratase XII, Carbonic Anhydrase XII, CA-XII, Tumor Antigen HOM-RCC-3.1.3) (Biotin)

Gene Names
CA12; CAXII; HsT18816
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA12; Polyclonal Antibody; CA12 (Carbonic Anhydrase 12; Carbonate Dehydratase XII; Carbonic Anhydrase XII; CA-XII; Tumor Antigen HOM-RCC-3.1.3) (Biotin); anti-CA12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CA12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CA12 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CA12, aa1-354 (NP_001209.1).
Immunogen Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CA12 rabbit polyclonal antibody. Western Blot analysis of CA12 expression in MCF-7.)

Western Blot (WB) (CA12 rabbit polyclonal antibody. Western Blot analysis of CA12 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of CA12 expression in transfected 293T cell line by CA12 polyclonal antibody. Lane 1: CA12 transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CA12 expression in transfected 293T cell line by CA12 polyclonal antibody. Lane 1: CA12 transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CA12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
771
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,451 Da
NCBI Official Full Name
carbonic anhydrase 12 isoform 1
NCBI Official Synonym Full Names
carbonic anhydrase XII
NCBI Official Symbol
CA12
NCBI Official Synonym Symbols
CAXII; HsT18816
NCBI Protein Information
carbonic anhydrase 12; CA-XII; carbonic dehydratase; carbonate dehydratase XII; tumor antigen HOM-RCC-3.1.3
UniProt Protein Name
Carbonic anhydrase 12
Protein Family
UniProt Gene Name
CA12
UniProt Synonym Gene Names
CA-XII
UniProt Entry Name
CAH12_HUMAN

NCBI Description

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CA12: Reversible hydration of carbon dioxide. Homodimer. Highly expressed in colon, kidney, prostate, intestine and activated lymphocytes. Expressed at much higher levels in the renal cell cancers than in surrounding normal kidney tissue. Moderately expressed in pancreas, ovary and testis. Inhibited by coumarins, saccharin, sulfonamide derivatives such as acetazolamide (AZA), benzenesulfonamide and derivatives (4-carboxyethylbenzene-sulfonamide, 4- carboxyethylbenzene-sulfonamide ethyl ester, 4-(acetyl-2- aminoethyl)benzene-sulfonamide, 4-aminoethylbenzene-sulfonamide) and Foscarnet (phosphonoformate trisodium salt). Belongs to the alpha-carbonic anhydrase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Energy Metabolism - nitrogen; EC 4.2.1.1; Membrane protein, integral; Lyase

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: integral to membrane; plasma membrane

Molecular Function: carbonate dehydratase activity; zinc ion binding

Biological Process: bicarbonate transport; one-carbon compound metabolic process; chloride ion homeostasis

Disease: Hyperchlorhidrosis, Isolated

Research Articles on CA12

Similar Products

Product Notes

The CA12 ca12 (Catalog #AAA6371796) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA12 (Carbonic Anhydrase 12, Carbonate Dehydratase XII, Carbonic Anhydrase XII, CA-XII, Tumor Antigen HOM-RCC-3.1.3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CA12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA12 ca12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.