Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of C9orf95 expression in transfected 293T cell line by C9orf95 polyclonal antibody. Lane 1: C9orf95 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human C9orf95 Polyclonal Antibody | anti-NMRK1 antibody

C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559)

Gene Names
NMRK1; NRK1; C9orf95; bA235O14.2; RP11-235O14.2
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
C9orf95; Polyclonal Antibody; C9orf95 (NMRK1; NRK1; Nicotinamide Riboside Kinase 1; Nicotinic Acid Riboside Kinase 1; Ribosylnicotinamide Kinase 1; Ribosylnicotinic Acid Kinase 1; FLJ20559); Anti -C9orf95 (NMRK1; anti-NMRK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C9orf95.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
Applicable Applications for anti-NMRK1 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human C9orf95, aa1-199 (NP_060351.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of C9orf95 expression in transfected 293T cell line by C9orf95 polyclonal antibody. Lane 1: C9orf95 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C9orf95 expression in transfected 293T cell line by C9orf95 polyclonal antibody. Lane 1: C9orf95 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of C9orf95 transfected lysate using C9orf95 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with C9orf95 purified mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of C9orf95 transfected lysate using C9orf95 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with C9orf95 purified mouse polyclonal antibody.)
Related Product Information for anti-NMRK1 antibody
Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM].
Product Categories/Family for anti-NMRK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23,193 Da
NCBI Official Full Name
C9orf95 protein
NCBI Official Synonym Full Names
nicotinamide riboside kinase 1
NCBI Official Symbol
NMRK1
NCBI Official Synonym Symbols
NRK1; C9orf95; bA235O14.2; RP11-235O14.2
NCBI Protein Information
nicotinamide riboside kinase 1; NRK 1; RNK 1; nmR-K 1; ribosylnicotinamide kinase 1; ribosylnicotinic acid kinase 1; nicotinic acid riboside kinase 1
UniProt Protein Name
Nicotinamide riboside kinase 1
UniProt Gene Name
NMRK1
UniProt Synonym Gene Names
C9orf95; NRK1; NRK 1; NmR-K 1; RNK 1
UniProt Entry Name
NRK1_HUMAN

NCBI Description

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM, Mar 2008]

Uniprot Description

NRK1: Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). The enzyme also phosphorylates the antitumor drugs tiazofurin and 3- deazaguanosine. Belongs to the uridine kinase family. NRK subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.22; Kinase, other; EC 2.7.1.173; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide

Chromosomal Location of Human Ortholog: 9q21.13

Molecular Function: ribosylnicotinamide kinase activity; metal ion binding; ATP binding

Biological Process: NAD biosynthetic process; phosphorylation

Research Articles on NMRK1

Similar Products

Product Notes

The NMRK1 nmrk1 (Catalog #AAA6009891) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C9orf95 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the NMRK1 nmrk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKTFIIGISG VTNSGKTTLA KNLQKHLPNC SVISQDDFFK PESEIETDKN GFLQYDVLEA LNMEKMMSAI SCWMESARHS VVSTDQESAE EIPILIIEGF LLFNYKPLDT IWNRSYFLTI PYEECKRRRS TRVYQPPDSP GYFDGHVWPM YLKYRQEMQD ITWEVVYLDG TKSEEDLFLQ VYEDLIQELA KQKCLQVTA. It is sometimes possible for the material contained within the vial of "C9orf95, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.