Western Blot (WB)
(C7ORF38 antibody (MBS5300814) used at 1 ug/ml to detect target protein.)
Rabbit C7ORF38 Polyclonal Antibody | anti-C7ORF38 antibody
C7ORF38 antibody
Gene Names
FAM200A; C7orf38
Applications
Western Blot
Purity
Affinity purified
Synonyms
C7ORF38; Polyclonal Antibody; C7ORF38 antibody; Polyclonal C7ORF38; Anti-C7ORF38; Chromosome ORF-7; DKFZp727G131; Chromosome 7 ORF; Chromosome ORF 7; FLJ36794; anti-C7ORF38 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C7ORF38 antibody was raised against the middle region of C7Orf38
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C7ORF38 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
573
Applicable Applications for anti-C7ORF38 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse.
Cross-Reactivity
Human
Immunogen
C7ORF38 antibody was raised using the middle region of C7Orf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C7ORF38 antibody (MBS5300814) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C7ORF38 antibody (MBS5300814) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C7ORF38 antibody
Rabbit polyclonal C7ORF38 antibody raised against the middle region of C7Orf38
Product Categories/Family for anti-C7ORF38 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
66 kDa (MW of target protein)
NCBI Official Full Name
Chromosome 7 open reading frame 38
NCBI Official Synonym Full Names
family with sequence similarity 200, member A
NCBI Official Symbol
FAM200A
NCBI Official Synonym Symbols
C7orf38
NCBI Protein Information
protein FAM200A
UniProt Protein Name
Protein FAM200A
UniProt Gene Name
FAM200A
UniProt Synonym Gene Names
C7orf38
UniProt Entry Name
F200A_HUMAN
NCBI Description
This gene encodes a protein of unknown function. The protein is weakly similar to transposase-like proteins in human and mouse. [provided by RefSeq, Jul 2008]
Uniprot Description
FAM200A: a protein of unknown function. The protein is weakly similar to transposase-like proteins in human and mouse. [provided by RefSeq, Jul 2008]
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 7q22.1
Cellular Component: integral to membrane
Molecular Function: nucleic acid binding
Similar Products
Product Notes
The C7ORF38 fam200a (Catalog #AAA5300814) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C7ORF38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C7ORF38 fam200a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C7ORF38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
