Western Blot (WB)
(WB Suggested Anti-C6orf134 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateATAT1 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit C6orf134 Polyclonal Antibody | anti-ATAT1 antibody
C6orf134 antibody - N-terminal region
Gene Names
ATAT1; TAT; MEC17; C6orf134; Nbla00487; alpha-TAT; alpha-TAT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
C6orf134; Polyclonal Antibody; C6orf134 antibody - N-terminal region; anti-ATAT1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
Sequence Length
323
Applicable Applications for anti-ATAT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C6orf134 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateATAT1 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-C6orf134 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateATAT1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ATAT1 antibody
This is a rabbit polyclonal antibody against C6orf134. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function remains unknown.
Target Description: The function remains unknown.
Product Categories/Family for anti-ATAT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36kDa
NCBI Official Full Name
alpha-tubulin N-acetyltransferase 1 isoform 2
NCBI Official Synonym Full Names
alpha tubulin acetyltransferase 1
NCBI Official Symbol
ATAT1
NCBI Official Synonym Symbols
TAT; MEC17; C6orf134; Nbla00487; alpha-TAT; alpha-TAT1
NCBI Protein Information
alpha-tubulin N-acetyltransferase 1
NCBI Description
This gene encodes a protein that localizes to clathrin-coated pits, where it acetylates alpha tubulin on lysine 40. This process may be important in microtubule growth, for instance during chemotaxis and the formation of cilium. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Research Articles on ATAT1
Similar Products
Product Notes
The ATAT1 (Catalog #AAA3206480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C6orf134 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C6orf134 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATAT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEFPFDVDAL FPERITVLDQ HLRPPARRPG TTTPARVDLQ QQIMTIIDEL. It is sometimes possible for the material contained within the vial of "C6orf134, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
