Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LOC285636 polyclonal antibody. Western Blot analysis of LOC285636 expression in HepG2.)

Mouse anti-Human C5orf51 Polyclonal Antibody | anti-C5orf51 antibody

C5orf51 (UPF0600 Protein C5orf51, Chromosome 5 Open Reading Frame 51, LOC285636)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C5orf51; Polyclonal Antibody; C5orf51 (UPF0600 Protein C5orf51; Chromosome 5 Open Reading Frame 51; LOC285636); Anti -C5orf51 (UPF0600 Protein C5orf51; anti-C5orf51 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C5orf51.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
Applicable Applications for anti-C5orf51 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C5orf51, aa1-294 (NP_787117.3).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LOC285636 polyclonal antibody. Western Blot analysis of LOC285636 expression in HepG2.)

Western Blot (WB) (LOC285636 polyclonal antibody. Western Blot analysis of LOC285636 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of C5orf51 expression in transfected 293T cell line by C5orf51 polyclonal antibody. Lane 1: LOC285636 transfected lysate (32.34kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C5orf51 expression in transfected 293T cell line by C5orf51 polyclonal antibody. Lane 1: LOC285636 transfected lysate (32.34kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-C5orf51 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33,620 Da
NCBI Official Full Name
C5orf51 protein
NCBI Official Synonym Full Names
chromosome 5 open reading frame 51
NCBI Official Symbol
C5orf51
NCBI Protein Information
UPF0600 protein C5orf51
UniProt Protein Name
UPF0600 protein C5orf51
Protein Family
UniProt Gene Name
C5orf51
UniProt Entry Name
CE051_HUMAN

Uniprot Description

C5orf51: Belongs to the UPF0600 family.

Chromosomal Location of Human Ortholog: 5p13.1

Similar Products

Product Notes

The C5orf51 c5orf51 (Catalog #AAA642245) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C5orf51 (UPF0600 Protein C5orf51, Chromosome 5 Open Reading Frame 51, LOC285636) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C5orf51 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the C5orf51 c5orf51 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAAVSSVVR RVEELGDLAQ AHIQQLSEAA GEDDHFLIRA SAALEKLKLL CGEEKECSNP SNLLELYTQA ILDMTYFEEN KLVDEDFPED SSSQKVKELI SFLSEPEILV KENNMHPKHC NLLGDELLEC LSWRRGALLY MYCHSLTKRR EWLLRKSSLL KKYLLDGISY LLQMLNYRCP IQLNEGVSFQ DLDTAKLLSA GIFSDIHLLA MMYSGEMCYW GSKYCADQQP ENHEVDTSVS GAGCTTYKEP LDFREVGEKI LKKYVSVCEG PLKEQEWNTT NAKQILNFFH HRCN. It is sometimes possible for the material contained within the vial of "C5orf51, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.