Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C2ORF33 antibody (MBS5303002) used at 1 ug/ml to detect target protein.)

Rabbit C2ORF33 Polyclonal Antibody | anti-C2ORF33 antibody

C2ORF33 antibody

Gene Names
MFF; GL004; C2orf33
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C2ORF33; Polyclonal Antibody; C2ORF33 antibody; Polyclonal C2ORF33; Anti-C2ORF33; Chromosome ORF 2; Chromosome ORF-2; DKFZp666J168; GL004; Chromosome 2 ORF; MGC110913; anti-C2ORF33 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
C2ORF33 antibody was raised against the C terminal Of C2Orf33
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF33 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
317
Applicable Applications for anti-C2ORF33 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C2orf33 plays a role in mitochondrial and peroxisomal fission.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
C2ORF33 antibody was raised using the C terminal Of C2Orf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C2ORF33 antibody (MBS5303002) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C2ORF33 antibody (MBS5303002) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C2ORF33 antibody
Rabbit polyclonal C2ORF33 antibody raised against the C terminal Of C2Orf33
Product Categories/Family for anti-C2ORF33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
38 kDa (MW of target protein)
NCBI Official Full Name
chromosome 2 open reading frame 33, isoform CRA_j
NCBI Official Synonym Full Names
mitochondrial fission factor
NCBI Official Symbol
MFF
NCBI Official Synonym Symbols
GL004; C2orf33
NCBI Protein Information
mitochondrial fission factor
UniProt Protein Name
Mitochondrial fission factor
UniProt Gene Name
MFF
UniProt Synonym Gene Names
C2orf33
UniProt Entry Name
MFF_HUMAN

NCBI Description

This is a nuclear gene encoding a protein that functions in mitochondrial and peroxisomal fission. The encoded protein recruits dynamin-1-like protein (DNM1L) to mitochondria. There are multiple pseudogenes for this gene on chromosomes 1, 5, and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]

Uniprot Description

MFF: Plays a role in mitochondrial and peroxisomal fission. Belongs to the tango11 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 2q36.3

Cellular Component: mitochondrial outer membrane; synaptic vesicle; peroxisome; cell junction

Molecular Function: protein binding; protein homodimerization activity

Biological Process: peroxisome fission; mitochondrial fission; release of cytochrome c from mitochondria; mitochondrial fusion; mitochondrial fragmentation during apoptosis; protein targeting to mitochondrion; protein homooligomerization

Research Articles on C2ORF33

Similar Products

Product Notes

The C2ORF33 mff (Catalog #AAA5303002) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C2ORF33 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C2ORF33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C2ORF33 mff for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C2ORF33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.