Immunohistochemistry (IHC)
(Human kidney )
Rabbit C21orf7 Polyclonal Antibody | anti-MAP3K7CL antibody
C21orf7 antibody - C-terminal region
Gene Names
MAP3K7CL; TAKL; TAK1L; TAKL-1; TAKL-2; TAKL-4; C21orf7; HC21ORF7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
C21orf7; Polyclonal Antibody; C21orf7 antibody - C-terminal region; anti-MAP3K7CL antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA
Sequence Length
242
Applicable Applications for anti-MAP3K7CL antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human C21orf7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human kidney )
Immunohistochemistry (IHC)
(Human kidney )
Related Product Information for anti-MAP3K7CL antibody
This is a rabbit polyclonal antibody against C21orf7. It was validated on Western Blot and immunohistochemistry
Target Description: C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
Target Description: C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
Product Categories/Family for anti-MAP3K7CL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
MAP3K7 C-terminal-like protein isoform 1
NCBI Official Synonym Full Names
MAP3K7 C-terminal like
NCBI Official Symbol
MAP3K7CL
NCBI Official Synonym Symbols
TAKL; TAK1L; TAKL-1; TAKL-2; TAKL-4; C21orf7; HC21ORF7
NCBI Protein Information
MAP3K7 C-terminal-like protein
UniProt Protein Name
MAP3K7 C-terminal-like protein
Protein Family
UniProt Gene Name
MAP3K7CL
UniProt Synonym Gene Names
C21orf7; TAK1L
UniProt Entry Name
M3KCL_HUMAN
Uniprot Description
MAP3K7CL: 4 isoforms of the human protein are produced by alternative splicing
Chromosomal Location of Human Ortholog: 21q22.3
Cellular Component: cytosol; nucleus
Molecular Function: MAP kinase kinase kinase activity; protein binding
Biological Process: activation of MAPKK activity; MAPKKK cascade
Similar Products
Product Notes
The MAP3K7CL map3k7cl (Catalog #AAA3206438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C21orf7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C21orf7 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MAP3K7CL map3k7cl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSEESMEVFK QHCQIAEEYH EVKKEITLLE QRKKELIAKL DQAEKEKVDA. It is sometimes possible for the material contained within the vial of "C21orf7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
