Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C20ORF20 antibody (MBS5300975) used at 2.5 ug/ml to detect target protein.)

Rabbit C20ORF20 Polyclonal Antibody | anti-C20ORF20 antibody

C20ORF20 antibody

Gene Names
MRGBP; Eaf7; URCC4; MRG15BP; C20orf20
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
C20ORF20; Polyclonal Antibody; C20ORF20 antibody; Polyclonal C20ORF20; Anti-C20ORF20; Chromosome ORF 20; Chromosome 20 ORF; Chromosome ORF-20; anti-C20ORF20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C20ORF20 antibody was raised against the N terminal Of C20Orf20
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C20ORF20 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
204
Applicable Applications for anti-C20ORF20 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.
Cross-Reactivity
Human
Immunogen
C20ORF20 antibody was raised using the N terminal Of C20Orf20 corresponding to a region with amino acids MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C20ORF20 antibody (MBS5300975) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (C20ORF20 antibody (MBS5300975) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-C20ORF20 antibody
Rabbit polyclonal C20ORF20 antibody raised against the N terminal Of C20Orf20
Product Categories/Family for anti-C20ORF20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
22 kDa (MW of target protein)
NCBI Official Full Name
chromosome 20 open reading frame 20, isoform CRA_a
NCBI Official Synonym Full Names
MRG/MORF4L binding protein
NCBI Official Symbol
MRGBP
NCBI Official Synonym Symbols
Eaf7; URCC4; MRG15BP; C20orf20
NCBI Protein Information
MRG/MORF4L-binding protein
UniProt Protein Name
MRG/MORF4L-binding protein
UniProt Gene Name
MRGBP
UniProt Synonym Gene Names
C20orf20; Urcc4
UniProt Entry Name
MRGBP_HUMAN

Uniprot Description

MRGBP: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Belongs to the EAF7 family.

Protein type: Acetyltransferase

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nucleoplasm; H4/H2A histone acetyltransferase complex; nucleus

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; regulation of growth; chromatin modification

Research Articles on C20ORF20

Similar Products

Product Notes

The C20ORF20 mrgbp (Catalog #AAA5300975) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C20ORF20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the C20ORF20 mrgbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C20ORF20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.