Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C1QC antibody Titration: 1 ug/mLSample Type: Human Ovary Tumor)

Rabbit C1QC Polyclonal Antibody | anti-C1QC antibody

C1QC Antibody - middle region

Gene Names
C1QC; C1QG; C1Q-C
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C1QC; Polyclonal Antibody; C1QC Antibody - middle region; anti-C1QC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAP
Sequence Length
245
Applicable Applications for anti-C1QC antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C1QC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C1QC antibody Titration: 1 ug/mLSample Type: Human Ovary Tumor)

Western Blot (WB) (WB Suggested Anti-C1QC antibody Titration: 1 ug/mLSample Type: Human Ovary Tumor)
Related Product Information for anti-C1QC antibody
This is a rabbit polyclonal antibody against C1QC. It was validated on Western Blot

Target Description: This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene.
Product Categories/Family for anti-C1QC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
714
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Full Name
complement C1q subcomponent subunit C isoform 1
NCBI Official Synonym Full Names
complement C1q C chain
NCBI Official Symbol
C1QC
NCBI Official Synonym Symbols
C1QG; C1Q-C
NCBI Protein Information
complement C1q subcomponent subunit C
UniProt Protein Name
Complement C1q subcomponent subunit C
UniProt Gene Name
C1QC
UniProt Synonym Gene Names
C1QG
UniProt Entry Name
C1QC_HUMAN

NCBI Description

This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. [provided by RefSeq, Dec 2016]

Uniprot Description

C1QC: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. Defects in C1QC are a cause of complement component C1q deficiency (C1QD). A rare defect resulting in C1 deficiency and impaired activation of the complement classical pathway. C1 deficiency generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: extracellular space; collagen; extracellular region

Biological Process: negative regulation of macrophage differentiation; innate immune response; immune response; complement activation, classical pathway; negative regulation of granulocyte differentiation; complement activation

Disease: C1q Deficiency

Research Articles on C1QC

Similar Products

Product Notes

The C1QC c1qc (Catalog #AAA3214643) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1QC Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C1QC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C1QC c1qc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKNGPMGPPG MPGVPGPMGI PGEPGEEGRY KQKFQSVFTV TRQTHQPPAP. It is sometimes possible for the material contained within the vial of "C1QC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.